DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq8 and AT1G65950

DIOPT Version :9

Sequence 1:NP_572836.1 Gene:Coq8 / 32239 FlyBaseID:FBgn0052649 Length:661 Species:Drosophila melanogaster
Sequence 2:NP_176770.2 Gene:AT1G65950 / 842907 AraportID:AT1G65950 Length:551 Species:Arabidopsis thaliana


Alignment Length:301 Identity:78/301 - (25%)
Similarity:153/301 - (50%) Gaps:25/301 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 NAERIVDTLCKV-RGAALKIGQILSIQDSSVVSPQLAKAFERVRQAADYMPDWQVERVMNTQLGA 340
            :|:||: .||:. :|..:|.||.  :....:|..:.:.|...::..|......::::|:.:.||.
plant    98 SAKRIL-KLCESNKGFYVKAGQF--VATLKLVPKEYSLALSSLQDKAVPCNFQEIKQVLTSNLGQ 159

  Fly   341 DWRQRLKSFEDKPFAAASIGQVHRATLSDGMDVAIKIQYPGVAQSIESDIDNLVGMLK-VWDVFP 404
            :..:...||:::|.|||||.|||.|.|.:..:||:|:||||:.|::..|...:..:.| |..:||
plant   160 NLTEIYLSFDEEPIAAASIAQVHHAVLKNHQEVAVKVQYPGLKQNMMLDTMIMSFLSKSVAKIFP 224

  Fly   405 QGFFIDNVVRVAKRELQWEVDYDREAEYTEKFREMIAPYPEYYVPRVVRDLTTSSVLTTELVPGV 469
            : :..|.:|....:.:..|:|:.:||:.:|:..:.........:|.|..:.||:.|||.:...|.
plant   225 E-YRFDWLVYEFVKSISQELDFLQEAKNSERIAKNFKHNKMITIPTVFSEFTTTQVLTMQFCKGF 288

  Fly   470 PLDKCFDLSYEHRRHIA----ASVLKLCLRELFEIE-CMQTDPNWSNFLYDAPSRR---LMLIDF 526
            .:|   |:....|.:::    |.||.....|:..:. .:..||:..|.|.....:.   |:|:|.
plant   289 KVD---DVESLKRTNVSPEKVAKVLVEVFAEMIFVHGFIHGDPHPGNILVSPEGQNGFSLVLLDH 350

  Fly   527 GSTR----FYRHEFIRNYRRVIMSAAENNRQGVLEMSREMG 563
            |:.:    .:|.:|.|.:..:|:  .::|:  :.|:.::.|
plant   351 GNCKTLDEAFRRDFCRLWEALIL--LDSNK--IQELGKQFG 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq8NP_572836.1 AarF 262..641 CDD:223733 78/301 (26%)
ABC1_ADCK3 313..563 CDD:270872 67/262 (26%)
AT1G65950NP_176770.2 ADCK1-like 136..387 CDD:270871 66/258 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.