DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq8 and AT1G61640

DIOPT Version :9

Sequence 1:NP_572836.1 Gene:Coq8 / 32239 FlyBaseID:FBgn0052649 Length:661 Species:Drosophila melanogaster
Sequence 2:NP_176358.2 Gene:AT1G61640 / 842460 AraportID:AT1G61640 Length:621 Species:Arabidopsis thaliana


Alignment Length:374 Identity:75/374 - (20%)
Similarity:146/374 - (39%) Gaps:64/374 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 TLCKVRGAALKIGQILSIQD---SSVVSPQLAKAFERVRQAADYMPDWQVERVMNTQLGADWRQR 345
            ||.|...|.:|.||.::.:.   :..:..||:|......:.:.......:|.....:|.    :.
plant   216 TLEKAGPAFIKFGQWIATRPDRFNKDLCLQLSKLHSNAPEHSFAFTKKSIENAFGRKLS----EI 276

  Fly   346 LKSFEDKPFAAASIGQVHRATLS--------DGMDVAIKIQYPGVAQSIESD--IDNLVGMLKVW 400
            .:.|::.|.|:.||.|||||:|.        ...:||:|:::|.|.::::.|  |.|.|..|..:
plant   277 FEEFDEAPVASGSIAQVHRASLKFQYAGQKVKSSEVAVKVRHPCVEETMKRDFVIINFVARLTTF 341

  Fly   401 DVFPQGFFIDNVVRVAKRELQWEVDYDREAEYTEKFREMIAPYPEYYVPRVVRDLTTSSVLTTEL 465
            ........:|..|:.....:..:||..|||.:..:|......:.:...|:.:..|...:||....
plant   342 IPGLNWLRLDECVQQFSVYMLSQVDLSREASHLSRFIYNFRGWKDVSFPKPIYPLIHPAVLVETY 406

  Fly   466 VPGVPLDKCFDLSYEHRR------HIAA-SVLKLCLRELFEIECMQTDPNWSNFLYDAPSRR--- 520
            ..|..:.:..|.|....:      ||.. ::||:.|.:.|    :..|.:..|.|....:.|   
plant   407 EHGESVARYVDGSEGQEKLKAKVAHIGTNALLKMLLVDNF----IHADMHPGNILVRPNNTRRGL 467

  Fly   521 -------LMLIDFGST----RFYRHEFIRNYRRVIMSAAENNRQGVLEMSRE------MGFLTGY 568
                   ::.:|.|.|    :..|...:..::.|.........:..|::|::      ..|:   
plant   468 FRSRKPHIVFLDVGMTAELSKTDRDNLLGFFKAVARRDGRTAAERTLKLSKQQNCPDPQAFI--- 529

  Fly   569 ETKQMEQAHVDAVMILGEIFRYDGDFDFGRQNTTERLAALVPTMVAHRL 617
              |::|:|           |.:.|..:....:..:.:..|...|.:||:
plant   530 --KEVEEA-----------FTFWGTEEGDLVHPADCMHELFEKMRSHRV 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq8NP_572836.1 AarF 262..641 CDD:223733 75/374 (20%)
ABC1_ADCK3 313..563 CDD:270872 56/286 (20%)
AT1G61640NP_176358.2 ADCK2-like 248..539 CDD:270873 61/314 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.