DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq8 and AT5G24810

DIOPT Version :9

Sequence 1:NP_572836.1 Gene:Coq8 / 32239 FlyBaseID:FBgn0052649 Length:661 Species:Drosophila melanogaster
Sequence 2:NP_001190388.1 Gene:AT5G24810 / 832550 AraportID:AT5G24810 Length:1040 Species:Arabidopsis thaliana


Alignment Length:449 Identity:109/449 - (24%)
Similarity:193/449 - (42%) Gaps:81/449 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   277 NAERIVDTLCKVRGAALKIGQILS----------------IQDSSVVSP--QLAKAF-------- 315
            ||:|:::.:.::.|..:|:||.||                :|||....|  ::.|.:        
plant    97 NAKRVLNLIVELEGLWVKLGQYLSTRADVLPQAYISLLTQLQDSLPPRPLQEVCKIYLNVNIRGY 161

  Fly   316 -ERVRQAADYMPDW---QVERVMNTQLGADWRQRLKSFEDKPFAAASIGQVHRATLSDGMDVAIK 376
             ::.:...|.|..|   :|.|.:..:||.........|.|:|.|.|||.|||||||::|.||.:|
plant   162 TKKEKYFFDIMSMWYDFKVCRTIERELGNSMDVLFTDFVDEPLATASIAQVHRATLANGQDVVVK 226

  Fly   377 IQYPGVAQSIESDIDNLVGMLKVWDVF--PQGFF---IDNVVRVAKRELQWEVDYDREAEYT--- 433
            :|:.|:...|..|:.|...::. |..:  ||..|   ||...:.|.|||    |::.|||.|   
plant   227 VQHDGIRAIILEDLKNAKSIVD-WIAWAEPQYNFNPMIDEWCKEAPREL----DFNIEAENTRTV 286

  Fly   434 ------EKFREMI--APYPEYYVPRVVRDLTTSSVLTTELVPGVPLD--KCFDLSYEHRRHIAAS 488
                  :|..:.:  |...:..:|.:::  ::.|||..|.:.||.|:  :..|.....::.|...
plant   287 SGNLGCKKTNDEVRSANRVDVLIPDIIQ--SSESVLILEYMDGVRLNDVESLDAFGVDKQKIVEE 349

  Fly   489 VLKLCLRELFEIECMQTDPNWSNFLYD-APSRRLMLIDFGSTRFYRHEFIRNYRRVIMSAAENNR 552
            :.:....::|.......||:..|||.. .|..|.:|:|||.::...|...:...::.:::||.::
plant   350 ITRAYAHQIFVDGFFNGDPHPGNFLVSKEPQHRPILLDFGLSKKISHSLKQALAKMFLASAEGDQ 414

  Fly   553 QGVLEMSREMGFLTGYETKQMEQAHVDAVMILGEIFRYD-------GDFDFGRQNTTERLAALVP 610
            ..:|....|||.....:...      .|:.:.|..||..       ..|........:.:..:..
plant   415 VALLSAFAEMGLKLRLDMPD------QAMSVAGLFFRSSTPSSEAMKTFKTLNDQRVQNMKVIQE 473

  Fly   611 TMVAH-----RLCPP---PEEIYSIHRKLSGIFLLCARLNVRMNCV----PFYKDIVLG 657
            .|..:     |..|.   |.:|....|.::.:..|.:.:|||:..:    ||.:.::||
plant   474 KMQLNQKEVKRFNPIDAFPGDIVIFARVINLLRGLSSTMNVRIVYLDIMRPFAESVLLG 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq8NP_572836.1 AarF 262..641 CDD:223733 102/427 (24%)
ABC1_ADCK3 313..563 CDD:270872 75/280 (27%)
AT5G24810NP_001190388.1 AarF 44..536 CDD:223733 109/449 (24%)
ABC1_ADCK3-like 136..421 CDD:270691 78/291 (27%)
Beta-lactamase 558..>846 CDD:278569
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.