DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq8 and AT5G05200

DIOPT Version :9

Sequence 1:NP_572836.1 Gene:Coq8 / 32239 FlyBaseID:FBgn0052649 Length:661 Species:Drosophila melanogaster
Sequence 2:NP_568150.1 Gene:AT5G05200 / 830402 AraportID:AT5G05200 Length:540 Species:Arabidopsis thaliana


Alignment Length:335 Identity:89/335 - (26%)
Similarity:157/335 - (46%) Gaps:30/335 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 QPAIE-VPELSKVAKQRKVPSSRIG--RMASFGGLFAGLGLGTLNELTKGALGLGGSTS-MREAL 272
            |..|| :|:|.:...|..:.:...|  |:......|.|:|...||:|:|.....||..| ::..|
plant    59 QSQIEKLPKLVEDIVQTSINTGPRGVTRLVQGVQAFVGVGGEWLNDLSKSTSASGGLPSELQLGL 123

  Fly   273 LSPANAERIVDTLCKVRGAA-LKIGQILSIQDSSVVSPQLAKAFERVRQAADYMPDWQVERVMNT 336
            |||....::.:.:    ||. :|:||.:: ...::..|:..|.|:.....|..:|..::.:::..
plant   124 LSPLYLRKLFERM----GATYIKLGQFIA-SAPTLFPPEYVKEFQNCFDKAPPVPFEEIRKILQE 183

  Fly   337 QLGADWRQRLKSFEDKPFAAASIGQVHRATLSDGM-DVAIKIQYPGVAQSIESDIDNLVGMLKVW 400
            :||.......:..:..|.|:|||.|||.|.|.... ||.||:..||:...:.:|::.:..:.:::
plant   184 ELGRPIESVYEYVDPTPIASASIAQVHGARLRGSQEDVVIKVLKPGIEDFLVADLNFIYVVSRIF 248

  Fly   401 DVFPQGFFIDNVVRVAK--RE-LQWEVDYDREAEYTEKFR---EMIAPYPEYYVPRVVRDLTTSS 459
            :.....|...::|.:.|  || :..|||:::||:..|.|:   |.:....:...|||.:..::..
plant   249 EFLSPEFSRTSLVGIVKDIRESMLEEVDFNKEAQNIESFKRYLETMGLTGQATAPRVYKYCSSRR 313

  Fly   460 VLTTELVPGVPLDKCFDLSYEHRRHIAAS-------VLKLCLRELFEIECMQTDPNWSNFLYDAP 517
            |||.|.:.||||.   ||  :..|.:.:|       .|.:....|...|....|.:..| |:...
plant   314 VLTMERLYGVPLT---DL--DSIRSLVSSPENSLITALNVWFGSLLACESFHADVHAGN-LWLLR 372

  Fly   518 SRRLMLIDFG 527
            ..|:..:|||
plant   373 DGRIGFLDFG 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq8NP_572836.1 AarF 262..641 CDD:223733 74/282 (26%)
ABC1_ADCK3 313..563 CDD:270872 61/229 (27%)
AT5G05200NP_568150.1 ABC1_ADCK3-like 165..414 CDD:270691 59/224 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.