DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq8 and AT4G24810

DIOPT Version :9

Sequence 1:NP_572836.1 Gene:Coq8 / 32239 FlyBaseID:FBgn0052649 Length:661 Species:Drosophila melanogaster
Sequence 2:NP_001031709.1 Gene:AT4G24810 / 828584 AraportID:AT4G24810 Length:481 Species:Arabidopsis thaliana


Alignment Length:426 Identity:101/426 - (23%)
Similarity:173/426 - (40%) Gaps:96/426 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 AERIVDTLCKVRGAALKIGQILSIQDSSVVSPQLAKAFERVRQ------AADYMPDWQVERVMNT 336
            |.::......:.|..|||.|||.       .|.||.| ..||:      .|...|...|..|:..
plant    65 AHKVYSMCSDLGGFFLKIAQILG-------KPDLAPA-AWVRKLVTLCDQAPATPFDAVRVVLEK 121

  Fly   337 QLGADWRQRLKSFEDKPFAAASIGQVHRATL-SDGMDVAIKIQYPGVAQSIESDIDNLVGMLKVW 400
            :||....|..::|::||..:|||.|||||.: .|..||.:|:|:|||.:.:..||.|    |:::
plant   122 ELGKSIEQVFETFDEKPLGSASIAQVHRARVKGDKRDVVVKVQHPGVEKLMMVDIRN----LQIF 182

  Fly   401 DVFPQ----GFFIDNVVRVAKRELQWEVDYDREAEYTEKFREMI------APYPEYYVPRVVRDL 455
            .::.|    .|.:.::.:..::::.:|.|:.|||...||.|..:      :|   ..||||..:|
plant   183 ALYMQKTDIKFDLFSMTKEIEKQIGYEFDFKREANAMEKIRRFLYDNNRKSP---VLVPRVFPNL 244

  Fly   456 TTSSVLTTELVPGVPLDKCFD------------LSYEHRRHIAASVLKLCLRELFEIECMQTDPN 508
            .|..||..|.:.|:|:....|            ::...:.:|..|:.:...:.:.:......||:
plant   245 VTRKVLVMEFMNGIPILSLGDEMAKRGINPHGKMAEAAKFNILHSLSQAYGQMILKSGFFHADPH 309

  Fly   509 WSNFLYDAPSRRLMLIDFGSTRFYRHEFIRNYRRVIMSAAENNRQGVLEMSREMGFLTGYETKQM 573
            ..|.|....| .:.|:|:|..:.........|..::::.|:||....|:..||:|..|..:.|  
plant   310 PGNILIGKGS-EVALLDYGQVKELPDHLRLGYANLVIAIADNNASLALQSFRELGIATVAKCK-- 371

  Fly   574 EQAHVDAVMILGEIFRYDGDFDFGRQNTTERLAALVPTMVAHRLCPP------------------ 620
                                      |..:.|..|..||....: ||                  
plant   372 --------------------------NEQQELLQLAKTMFDTEM-PPGTTTLQPFSEDSSIKKIS 409

  Fly   621 ----PEEIYSIHRKLSGIFLLCARLNVRMNCVPFYK 652
                |||::|:.|.:..:..|...:.:..:|...::
plant   410 VEAFPEELFSVLRTVVLLRGLSVGIGINYSCAQHWR 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq8NP_572836.1 AarF 262..641 CDD:223733 100/413 (24%)
ABC1_ADCK3 313..563 CDD:270872 73/278 (26%)
AT4G24810NP_001031709.1 ABC1_ADCK3-like 103..359 CDD:270691 68/263 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.