DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq8 and Adck2

DIOPT Version :9

Sequence 1:NP_572836.1 Gene:Coq8 / 32239 FlyBaseID:FBgn0052649 Length:661 Species:Drosophila melanogaster
Sequence 2:NP_849204.1 Gene:Adck2 / 57869 MGIID:1889336 Length:617 Species:Mus musculus


Alignment Length:437 Identity:76/437 - (17%)
Similarity:132/437 - (30%) Gaps:157/437 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 LKIGQILSIQDSSVVSPQLAKAFERVRQAADYMPDWQVERVMNTQLGADWRQRLKSFEDKPFAAA 357
            :|:||..|.: ..:.|......|.::.......|..:.|.::....|.||...|.....:|..:.
Mouse   146 IKLGQWASTR-RDLFSEAFCTQFSKLHVQVTPHPWARTEYLLQQAFGEDWGSLLFFETREPVGSG 209

  Fly   358 SIGQVHRA-----------------------------------------TLSDG----------- 370
            .:.||::|                                         .|:|.           
Mouse   210 CVAQVYKAFASISLLEEDRIWRLGELSAPGTRAVVMQREPFMKDRKPSENLADEAFLEKLLLPKA 274

  Fly   371 ----------------------MDVAIKIQYPGVAQSIESDI------DNLVGMLK--VWDVFPQ 405
                                  :.||:|:.:||:...:..|:      ...:|:|.  .|...|:
Mouse   275 DLGGSEVGVSQAPWHLPKSDHLIPVAVKVLHPGLLSQVSMDLLLMKIGSKALGLLPGVKWLSLPE 339

  Fly   406 GFFIDNVVRVAKRELQWEVDYDREAEYTEKFREMIAPYPEYYVPRVVRDLTTSSVLT---TELVP 467
                  :|...::.:..:.|...||:..|.|:...........|..:|.|.|..:|.   .|.||
Mouse   340 ------IVEEFEKLMVQQTDLRYEAQNLEHFQHNFQDMASVKFPTPLRPLITRDILVETYEESVP 398

  Fly   468 -------GVPLDKCFDLSYEHRRHIAASVLKLCLRELFEIECMQTDPNWSNFLYD---------- 515
                   |:|.|.        :|.||...:.:.|:.:|....:..|.:..|.|..          
Mouse   399 VSSYQQAGIPTDL--------KRKIAQLGINMLLKMIFVDNFVHGDLHPGNILVQGADGVSPSLE 455

  Fly   516 ----------------APS---RRLMLIDFGSTRFYRHEFIRNYRRVIMS--------------- 546
                            ||:   .||:|:|.|.....:...:||:|.|..:               
Mouse   456 MQQQQVNVCDTLVATIAPALCPLRLVLLDAGIVAKLQASDLRNFRAVFQAVVMGQGHRVAELMLH 520

  Fly   547 -AAENNRQGVLEMSREMGFLTGYETKQ---MEQAHVDAVMILGEIFR 589
             |..|..:.|.....||..|.....|.   :|:.||.:  :|..:|:
Mouse   521 HAQANECKDVERFKAEMATLVTQARKNIVTLEKLHVSS--LLSSVFK 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq8NP_572836.1 AarF 262..641 CDD:223733 76/437 (17%)
ABC1_ADCK3 313..563 CDD:270872 63/386 (16%)
Adck2NP_849204.1 UbiB 98..609 CDD:273909 76/437 (17%)
ADCK2-like 169..544 CDD:270873 64/388 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.