DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq8 and ADCK1

DIOPT Version :9

Sequence 1:NP_572836.1 Gene:Coq8 / 32239 FlyBaseID:FBgn0052649 Length:661 Species:Drosophila melanogaster
Sequence 2:NP_001353416.1 Gene:ADCK1 / 57143 HGNCID:19038 Length:580 Species:Homo sapiens


Alignment Length:398 Identity:98/398 - (24%)
Similarity:157/398 - (39%) Gaps:76/398 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 RIGRMASFGGLFAGLGLGTLNELTKGA---LGLGGSTSMREALLSPANAERIVDTLCKVRGAALK 294
            |:||..:...:.:...|.:|..:..|:   |.|.....:|       :|.|:.:..|..||..:|
Human    38 RVGRAVATTAVISYDYLTSLKSVPYGSEEYLQLRSKVHLR-------SARRLCELCCANRGTFIK 95

  Fly   295 IGQILSIQDSSVVSPQLAKAFERVRQAADYMPDWQVERVMNTQLGADWRQRLKSFEDKPFAAASI 359
            :||.|...| .::..:.....:.:...|......::.:|:...||.:.....:||:|.|...||:
Human    96 VGQHLGALD-YLLPEEYTSTLKVLHSQAPQSSMQEIRQVIREDLGKEIHDLFQSFDDTPLGTASL 159

  Fly   360 GQVHRATLSDGMDVAIKIQYPGV-AQSIESDIDNLVGMLKVWDVFPQGFFIDNVVRVAKRELQWE 423
            .|||:|.|.||..||:|:|:|.| |||.:..:...|.:|.|..:||:..|: .:|..||:.|..|
Human   160 AQVHKAVLHDGRTVAVKVQHPKVRAQSSKDILLMEVLVLAVKQLFPEFEFM-WLVDEAKKNLPLE 223

  Fly   424 VDYDREAEYTEKFREMIAPYPEYYVPRVVRDLTTSSVLTTELV---------------------- 466
            :|:..|....||..:|:..:....|||:..||:|..||..|.|                      
Human   224 LDFLNEGRNAEKVSQMLRHFDFLKVPRIHWDLSTERVLLMEFVDGGQVNDRDYMERNKIDVNEVR 288

  Fly   467 --------------PGVPLDKCFDLSYEHRRHI-------------AASVL----------KLCL 494
                          .|.|...|...|.|...|:             |.|.|          |:..
Human   289 SRAQGCCAGERGLGQGCPGSACVSRSSEKVSHLLSANDFSSSYHVQALSALATIEISRHLGKMYS 353

  Fly   495 RELFEIECMQTDPNWSNFLY----DAPSRRLMLIDFGSTRFYRHEFIRNYRRVIMSAAENNRQGV 555
            ..:|....:..||:..|.|.    ......::|:|.|..:....||..||..:..|....:.:.|
Human   354 EMIFVNGFVHCDPHPGNVLVRKHPGTGKAEIVLLDHGLYQMLTEEFRLNYCHLWQSLIWTDMKRV 418

  Fly   556 LEMSREMG 563
            .|.|:.:|
Human   419 KEYSQRLG 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq8NP_572836.1 AarF 262..641 CDD:223733 91/366 (25%)
ABC1_ADCK3 313..563 CDD:270872 78/313 (25%)
ADCK1NP_001353416.1 ADCK1-like 117..426 CDD:270871 78/309 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.