DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq8 and Adck1

DIOPT Version :9

Sequence 1:NP_572836.1 Gene:Coq8 / 32239 FlyBaseID:FBgn0052649 Length:661 Species:Drosophila melanogaster
Sequence 2:NP_001286851.1 Gene:Adck1 / 37938 FlyBaseID:FBgn0035039 Length:518 Species:Drosophila melanogaster


Alignment Length:297 Identity:74/297 - (24%)
Similarity:136/297 - (45%) Gaps:18/297 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 AERIVDTLCKVRGAALKIGQILSIQDSSVVSPQLAKAFERVRQAADYMPDWQVERVMNTQLGADW 342
            ||:::..:|..:|..:|:||.:...: .::..:..:..:.:...|...|...:.:|:...|..:.
  Fly    80 AEKLLQLICINKGVYIKVGQHIGALE-YLLPKEFVQTMKVLHSDAPQNPIEDLYKVIRQDLHCNP 143

  Fly   343 RQRLKSFEDKPFAAASIGQVHRATLSDGMDVAIKIQYPGVAQSIESDIDNL---VGMLKVWDVFP 404
            .:...|||.:|...||:.|||:|.|..|..||:|:|:|.|..:...|:..:   |.:|.  .:||
  Fly   144 EEIFDSFEREPLGTASLAQVHKARLKTGELVAVKVQHPYVKGNSRVDMKTMELAVNVLA--RIFP 206

  Fly   405 QGFFIDNVVRVAKRELQWEVDYDREAEYTEKFREMIAPYPEYYVPRVVRDLTTSSVLTTELVPGV 469
            . |.|..:|..:|:.|..|:|:..|....||..:....|....||::....::|.||..|.:.| 
  Fly   207 D-FKIHWLVEESKKNLPIELDFLNEGRNAEKVAKQFKKYSWLRVPKIYWKYSSSRVLVMEYLEG- 269

  Fly   470 PLDKCFDLSYEHRRHI-----AASVLKLCLRELFEIECMQTDPNWSNFLY---DAPSRRLMLIDF 526
              ....||.|..|..|     |..:.:|....:|....:.:||:..|.|.   ...|..::|:|.
  Fly   270 --GHVTDLDYIRRNKIDSFAVANRIGQLYSEMIFRTGFVHSDPHPGNILVRRTPENSLEIVLLDH 332

  Fly   527 GSTRFYRHEFIRNYRRVIMSAAENNRQGVLEMSREMG 563
            |.......:|..:|..:.:|..:.:|:.:.:.|.::|
  Fly   333 GLYANLTDKFRYDYSNLWLSILKVDRKAMRQHSEQLG 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq8NP_572836.1 AarF 262..641 CDD:223733 74/297 (25%)
ABC1_ADCK3 313..563 CDD:270872 66/260 (25%)
Adck1NP_001286851.1 ADCK1-like 118..369 CDD:270871 66/256 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454074
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.