DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq8 and Adck1

DIOPT Version :9

Sequence 1:NP_572836.1 Gene:Coq8 / 32239 FlyBaseID:FBgn0052649 Length:661 Species:Drosophila melanogaster
Sequence 2:XP_038968578.1 Gene:Adck1 / 366698 RGDID:1308263 Length:523 Species:Rattus norvegicus


Alignment Length:344 Identity:90/344 - (26%)
Similarity:154/344 - (44%) Gaps:25/344 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 RIGRMASFGGLFAGLGLGTLNELTKGALGLGGSTSMREALLSPANAERIVDTLCKVRGAALKIGQ 297
            |:||..:...:.:...|.:|..:..|:    .....|.:.:...:|.|:.:..|..||..:|:||
  Rat    38 RVGRAVATTAVISYDYLTSLRSVPYGS----EEYLQRRSQVHLRSARRLCELCCANRGTFIKVGQ 98

  Fly   298 ILSIQDSSVVSPQLAKAFERVRQAADYMPDWQVERVMNTQLGADWRQRLKSFEDKPFAAASIGQV 362
            .|...| .::..:.....:.:...|......:|.:|:...||.:......||:|.|..|||:.||
  Rat    99 HLGALD-YLLPEEYTSTLKVLHSQAPQSSMQEVRQVIREDLGKEIHDLFLSFDDTPLGAASLAQV 162

  Fly   363 HRATLSDGMDVAIKIQYPGV-AQSIESDIDNLVGMLKVWDVFPQGFFIDNVVRVAKRELQWEVDY 426
            |:|.|.||..||:|:|:|.| |||.:..:...|.:|.|..:||...|: .:|..||:.|..|:|:
  Rat   163 HKAVLHDGRTVAVKVQHPKVQAQSSKDILLMEVLVLAVKQLFPDFEFM-WLVDEAKKNLPLELDF 226

  Fly   427 DREAEYTEKFREMIAPYPEYYVPRVVRDLTTSSVLTTELVPGVPLDKCFDLSYEHRRHIAASVLK 491
            ..|....||...|:..:....||::..:|:|..||..|.|.|..::   |.:|..:..|..:.:.
  Rat   227 LNEGRNAEKVAHMLKHFDFLKVPQIHWELSTKRVLLMEFVEGGQVN---DRAYMEKNRIDVNEIS 288

  Fly   492 LCLRELFE--------IECMQTDPNWSNFLY----DAPSRRLMLIDFGSTRFYRHEFIRNYRRVI 544
            ..|.:::.        :.|   ||:..|.|.    |.....::|:|.|..:....||..:|..:.
  Rat   289 CHLGKMYSEMIFVNGFVHC---DPHPGNVLVRKRPDTGKAEIVLLDHGLYQVLTEEFRLDYCNLW 350

  Fly   545 MSAAENNRQGVLEMSREMG 563
            .|....:...|...|:.:|
  Rat   351 QSLIWTDLDRVKYYSQRLG 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq8NP_572836.1 AarF 262..641 CDD:223733 84/315 (27%)
ABC1_ADCK3 313..563 CDD:270872 72/262 (27%)
Adck1XP_038968578.1 ADCK1-like 117..369 CDD:270871 72/258 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.