DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq8 and Adck5

DIOPT Version :9

Sequence 1:NP_572836.1 Gene:Coq8 / 32239 FlyBaseID:FBgn0052649 Length:661 Species:Drosophila melanogaster
Sequence 2:NP_766548.2 Gene:Adck5 / 268822 MGIID:2679274 Length:582 Species:Mus musculus


Alignment Length:426 Identity:101/426 - (23%)
Similarity:178/426 - (41%) Gaps:89/426 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 LSKVAKQRKVPSS-----RIGRMASFGGLFAGLGLGT-----LNELTKGALGLGGSTSMREALLS 274
            :::.:::||:..:     |.||....     ||.:.|     .|.:.:|.    ...|.:...:.
Mouse    68 MAEASERRKLRLAVDGIGRFGRSVKI-----GLFISTDYWWCTNVVLRGV----EENSPKYVEIM 123

  Fly   275 PANAERIVDTLCKVRGAA------LKIGQILS----------IQDSSVVSPQ-LAKAFERVRQAA 322
            .|..:|..|||  |.||.      :|:||.|.          ||...|:..: |.:.|..|.:. 
Mouse   124 SACHQRAADTL--VAGAIRNGGLYVKLGQGLCSFNHLLPTEYIQTLRVLEDKALTRGFREVDEL- 185

  Fly   323 DYMPDWQVERVMNTQLGADWRQRLKSFEDKPFAAASIGQVHRATLSDGMDVAIKIQYPGVAQSIE 387
             ::.|:|   .:..:|       .:.|:.:|.||||:.|||||.|.||.|||:|:||..:....:
Mouse   186 -FLEDFQ---ALPNEL-------FQEFDYEPMAAASLAQVHRAKLHDGTDVAVKVQYIDLRDRFD 239

  Fly   388 SDIDNLVGMLKVWDVFPQGFFIDNVVRVAKRELQWEVDYDREAEYTEKFREMIAPYPEYYVPRVV 452
            .|:..|..:|::.::....|....|::..|..|..|:|::.|....|:..:.:..:....:|||.
Mouse   240 GDVQTLELLLRLVELMHPSFGFSWVLQDLKGTLVQELDFENEGRNAERCAQELKHFHYVVIPRVH 304

  Fly   453 RDLTTSSVLTTELVPGVPLD-----KCFDLSYEHRRHIAASVLKLCLRELFEIECMQTDPNWSNF 512
            .|.::..|||.:...|..::     |...|:.:   .:|..:::....::|....:.:||:..|.
Mouse   305 WDRSSKRVLTADFCNGCKVNDMEGIKSQGLAVQ---DVAKKLIQTFAEQIFHTGFIHSDPHPGNV 366

  Fly   513 LY-DAPSRR--LMLIDFGSTRFY----RHEFIRNYRRVIM--SAAENNRQGVLE----------- 557
            |. ..|..:  |:|:|.|..:|.    |....:.:|.:|:  :||.......|.           
Mouse   367 LVRKGPDGKAELVLLDHGLYQFLDEKDRSSLCQLWRAIILRDNAAMKKHAAALGVQDYMLFSEVL 431

  Fly   558 MSR--EMGFLTGYETKQMEQA---------HVDAVM 582
            |.|  .:|.|.|......|:|         |.|.:|
Mouse   432 MQRPVRLGQLWGSHLISREEAAYMQDMAREHFDGIM 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq8NP_572836.1 AarF 262..641 CDD:223733 91/374 (24%)
ABC1_ADCK3 313..563 CDD:270872 66/276 (24%)
Adck5NP_766548.2 AarF 78..568 CDD:223733 99/416 (24%)
ADCK1-like 169..420 CDD:270871 65/265 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.