DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq8 and exosc5

DIOPT Version :9

Sequence 1:NP_572836.1 Gene:Coq8 / 32239 FlyBaseID:FBgn0052649 Length:661 Species:Drosophila melanogaster
Sequence 2:XP_002939437.3 Gene:exosc5 / 100170617 XenbaseID:XB-GENE-6257997 Length:215 Species:Xenopus tropicalis


Alignment Length:200 Identity:41/200 - (20%)
Similarity:68/200 - (34%) Gaps:63/200 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   423 EVDYDREAEYTEKFREMIAP------YPEYYVPRVVRDLTTSSVLTTELVPGVPLDKCFDLSYEH 481
            |:...||.........::.|      ..|....:::|: |..||:...|.|...:.....:..: 
 Frog    43 EIKVSREIHNKATLEVILRPKTGLPAIQEKNQEQLIRE-TCESVIIGSLHPRTSITIVLQIVSD- 105

  Fly   482 RRHIAASVLKLCL--------------RELF-EIEC-------MQTDPNWSNFLYDAPSRRLMLI 524
                |.|:|..||              |.|| .:.|       :..||   ||.....||.::..
 Frog   106 ----AGSLLSCCLNAACMGLMDAGLPMRALFCGVTCAMDNDGTITLDP---NFRQQKESRAVLTF 163

  Fly   525 DFGSTRFYRHEFIRNYRRVIMSAAENNRQGVLEMSREMGFLTGYETKQMEQAHVDAVMILGEIFR 589
            ...||.          |:|:|.   :|| ||            |...:::|....|.:...::|:
 Frog   164 AIESTE----------RKVLMM---SNR-GV------------YSATELQQCIAAAQIASEKLFQ 202

  Fly   590 YDGDF 594
            :..||
 Frog   203 FYRDF 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq8NP_572836.1 AarF 262..641 CDD:223733 40/199 (20%)
ABC1_ADCK3 313..563 CDD:270872 35/167 (21%)
exosc5XP_002939437.3 RNase_PH_RRP46 8..205 CDD:206777 39/196 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR43851
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.