DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Coq8 and renbp

DIOPT Version :9

Sequence 1:NP_572836.1 Gene:Coq8 / 32239 FlyBaseID:FBgn0052649 Length:661 Species:Drosophila melanogaster
Sequence 2:NP_001106581.1 Gene:renbp / 100127793 XenbaseID:XB-GENE-977425 Length:403 Species:Xenopus tropicalis


Alignment Length:278 Identity:60/278 - (21%)
Similarity:85/278 - (30%) Gaps:106/278 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 AGLGLGTLNELTKGALGLGGSTSMREALLSPANAERIVDTLCKVRGAALKIGQILSIQDSSVVSP 309
            :|||...|    .||..|       .|:..|.....:||.||:                   ...
 Frog   162 SGLGKAEL----PGAAPL-------NAMAVPMMLLNLVDQLCE-------------------GDE 196

  Fly   310 QLAKAFERVRQAADYMPDWQVERVMNTQLGADWRQRLKSFEDK-------------PFAAASIGQ 361
            .:||.:|.|.:       |.||::|. .|..|.:..|::..|:             |..|...|.
 Frog   197 DMAKKYEEVGK-------WSVEKIMQ-HLQRDGKAILENVSDQGQELPGCLGRHQNPGHAIEAGW 253

  Fly   362 V---HRATLSDGMDVAIKIQYPGVAQ-SIESDIDNLVGMLKVWDVFPQGFF-IDNVVRVAKRELQ 421
            .   |....||          ..:|| |:|..:  |:..|..||....|.| ..:|......:|:
 Frog   254 FLLRHAIAHSD----------HSLAQTSVEKFM--LLPFLSGWDQEYGGLFSFQDVDGHCPTQLE 306

  Fly   422 WEV-----------------DYDREAEYTEKFREMIAPY-------PEY-----YVPRVVRDLTT 457
            |.:                 ...|:....|.| |.|..|       ||.     |:.|      .
 Frog   307 WNMKLWWPHTEALIAFLLAYQKTRDQRLLEHF-EKICDYVFRRFSDPEQGEWFGYLNR------E 364

  Fly   458 SSVLTTELVPGVPLDKCF 475
            .:|..|  :.|.|...||
 Frog   365 GNVALT--IKGGPFKGCF 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Coq8NP_572836.1 AarF 262..641 CDD:223733 54/261 (21%)
ABC1_ADCK3 313..563 CDD:270872 46/210 (22%)
renbpNP_001106581.1 AGE 3..396 CDD:238153 60/278 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165169106
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR43851
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.