DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nep6 and nep-4

DIOPT Version :9

Sequence 1:NP_001245645.1 Gene:Nep6 / 32234 FlyBaseID:FBgn0030425 Length:655 Species:Drosophila melanogaster
Sequence 2:NP_509156.2 Gene:nep-4 / 183746 WormBaseID:WBGene00016896 Length:437 Species:Caenorhabditis elegans


Alignment Length:173 Identity:46/173 - (26%)
Similarity:70/173 - (40%) Gaps:36/173 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   510 LGYI---LAHEMVHAF-----DLDGLNYDATGQLANGQWSARAIIRFGLRAGC---YLGV---RY 560
            |||.   :.||:.|.|     :.|||.|.:.        .|...::......|   |.|.   ..
 Worm   265 LGYTGTRVGHEIGHTFIEHSINPDGLPYFSK--------PAEDCVQNQYLKTCNEYYEGEVPDAC 321

  Fly   561 SNATLTVNENIADTEGLRLAL--------DTYRHRSGA---TNLRTFFVAFAQNWCGTVASTSGL 614
            :.:..|.::|.||..||:||.        |..|.::..   ||.:..|.:||..:|....|.:..
 Worm   322 NTSDYTFDDNGADVFGLQLAYAILERDLSDQLREQADGLKITNEQLLFYSFAYRFCRGSKSNTTD 386

  Fly   615 SQHAGHAERVNNVVGNMPEFGDTFECKATSQM--NPVNKCHIW 655
            ..|:.|..|: |.|..||.|...|.|.:.|:|  :...:|.|:
 Worm   387 GSHSHHNVRI-NAVAQMPGFQQAFNCASDSRMMKSATKQCVIY 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nep6NP_001245645.1 PepO 35..655 CDD:226118 45/171 (26%)
M13 40..653 CDD:189000 44/169 (26%)
nep-4NP_509156.2 GluZincin 250..425 CDD:387391 44/168 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3590
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11733
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.