DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde9 and PDE2

DIOPT Version :9

Sequence 1:NP_727644.3 Gene:Pde9 / 32233 FlyBaseID:FBgn0259171 Length:1623 Species:Drosophila melanogaster
Sequence 2:NP_015005.1 Gene:PDE2 / 854542 SGDID:S000005887 Length:526 Species:Saccharomyces cerevisiae


Alignment Length:439 Identity:114/439 - (25%)
Similarity:173/439 - (39%) Gaps:100/439 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   592 NGNNGN-----NGN---------NEYSILQLNNTIIQCHFNDDDFRALVK-DLKRKVEYTERMNW 641
            :|.|.|     |||         |.|::|        .|.||...:.|.| .:.|.:...|.|::
Yeast   133 DGINKNSYGTVNGNSVPTQACEANIYTLL--------LHLNDSKAQHLRKASVPRLIRNIEFMSF 189

  Fly   642 LCLSKRPLGPPHRKSSLPKHQEVKRRFLEICDTTFSEEVRAALRLPAFDSYEWSDADVIHLMQTM 706
            |            ...:.|..:....:..|..|.            .|.:...|..::|....|:
Yeast   190 L------------SDPIEKISQEGSHYWNILSTW------------DFCALSLSTQELIWCGFTL 230

  Fly   707 FVELGFIEKFSIPVDTLREWLYEVYKHYNEV-PFHNFRHCFCVAQMMYAITRQANLLSRLGDLEC 770
            ..:|....|..|..:.|...|:.:...|::| .||||||..   .:|.|..|....|.:...::.
Yeast   231 IKKLSKDAKVLIADNKLLLLLFTLESSYHQVNKFHNFRHAI---DVMQATWRLCTYLLKDNPVQT 292

  Fly   771 LILLVSCICHDLDHPGYNNIYQINARTELALRYNDISPLENHHCSIAFRLL-EH-PECNIFKNFS 833
            |:|.::.|.||:.|||.||....|..:|:|..:.::|.|||.|..:..:|| || |:   ..:.|
Yeast   293 LLLCMAAIGHDVGHPGTNNQLLCNCESEVAQNFKNVSILENFHRELFQQLLSEHWPQ---LLSIS 354

  Fly   834 RDTFNNIREGIIRCILATDMARHNEILTQFMEITPIFDYSNRAHINLLCMILIKVADISNEARPM 898
            :..|:.|.|    .|||||||.|::...:.|...|:      ..|.|:.:| ||.|||||..|.:
Yeast   355 KKKFDFISE----AILATDMALHSQYEDRLMHENPM------KQITLISLI-IKAADISNVTRTL 408

  Fly   899 DVAEPWL--------DRLLQEFF-----------------AQSAAEKSEGLP--VTPFMDPDKVS 936
            .::..|.        |..|.|.|                 ..|..|..|.:.  :....|||.:.
Yeast   409 SISARWAYLITLEFNDCALLETFHKAHRPEQDCFGDSYKNVDSPKEDLESIQNILVNVTDPDDII 473

  Fly   937 K-----PGSQVRFIGLVLLPLFEALGELVPELTELIIIPVRIALEYYRR 980
            |     |..|:.||.......|.||.:....| :.:...|:|..||:.:
Yeast   474 KDHPHIPNGQIFFINTFAEVFFNALSQKFSGL-KFLSDNVKINKEYWMK 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde9NP_727644.3 PDEase_I 739..967 CDD:278654 78/261 (30%)
PDE2NP_015005.1 PDEase_I 264..513 CDD:395177 78/266 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I1950
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46491
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2223
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.