DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde9 and pde4b

DIOPT Version :9

Sequence 1:NP_727644.3 Gene:Pde9 / 32233 FlyBaseID:FBgn0259171 Length:1623 Species:Drosophila melanogaster
Sequence 2:XP_031756141.1 Gene:pde4b / 780324 XenbaseID:XB-GENE-963512 Length:733 Species:Xenopus tropicalis


Alignment Length:279 Identity:89/279 - (31%)
Similarity:151/279 - (54%) Gaps:16/279 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   702 LMQTMFVELGFIEKFSIPVDTLREWLYEVYKHY-NEVPFHNFRHCFCVAQMMYAITRQANLLSRL 765
            :|..:|.|...::.|.||.|||..:...:..|| ::|.:||..|...|.|..:.:.....|.:..
 Frog   365 IMYAIFQERDLLKTFKIPADTLITYTMTLEDHYHSDVAYHNSLHAADVTQSTHVLLSTPALDAVF 429

  Fly   766 GDLECLILLVSCICHDLDHPGYNNIYQINARTELALRYNDISPLENHHCSIAFRLLEHPECNIFK 830
            .|||.|..:.:...||:||||.:|.:.||..:||||.|||.|.|||||.::.|:||:...|:||:
 Frog   430 TDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEEHCDIFQ 494

  Fly   831 NFSRDTFNNIREGIIRCILATDMARHNEILTQFMEITP-----------IFDYSNRAHINLLCMI 884
            |.::....::|:.:|..:|||||::|..:|.....:..           :.:|::|..:   ...
 Frog   495 NLTKKQRQSLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTSSGVLLLDNYTDRIQV---LRN 556

  Fly   885 LIKVADISNEARPMDVAEPWLDRLLQEFFAQSAAEKSEGLPVTPFMDPDKVSKPGSQVRFIGLVL 949
            ::..||:||..:.:::...|.||:::|||.|...|:..|:.::|..|....|...|||.||..::
 Frog   557 MVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEISPMCDKHTASVEKSQVGFIDYIV 621

  Fly   950 LPLFEALGELV-PELTELI 967
            .||:|...:|| |:..:::
 Frog   622 HPLWETWADLVQPDAQDIL 640

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde9NP_727644.3 PDEase_I 739..967 CDD:278654 77/239 (32%)
pde4bXP_031756141.1 PDE4_UCR 164..279 CDD:407935
PDEase_I 403..644 CDD:395177 77/241 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.