DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde9 and pde5ab

DIOPT Version :9

Sequence 1:NP_727644.3 Gene:Pde9 / 32233 FlyBaseID:FBgn0259171 Length:1623 Species:Drosophila melanogaster
Sequence 2:XP_005166620.1 Gene:pde5ab / 553270 ZFINID:ZDB-GENE-060824-4 Length:868 Species:Danio rerio


Alignment Length:316 Identity:101/316 - (31%)
Similarity:156/316 - (49%) Gaps:23/316 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   662 QEVKRRFLEICDTTFSEEVRA-------------ALRLP--AFDSYEWSDADVIHLMQTMFVELG 711
            |||....|....:...||.||             :|||.  :|..::.:||:.......|||:|.
Zfish   517 QEVTLEVLSYHASAAEEETRALQVTAAATIPSAQSLRLMDYSFSDFDLTDAETTQATIRMFVDLK 581

  Fly   712 FIEKFSIPVDTLREWLYEVYKHYNE-VPFHNFRHCFCVAQMMYAITRQANLLSRLGDLECLILLV 775
            .::.|.|...:|.:|:..|.|:|.: |.:||:||.|..:|.|:|:.:...:.:.|.|||.|.|::
Zfish   582 LVQNFQIKYKSLCQWILSVKKNYRKNVVYHNWRHAFNTSQCMFAVLKSGRVQNNLSDLETLALMI 646

  Fly   776 SCICHDLDHPGYNNIYQINARTELALRYNDISPLENHHCSIAFRLLEHPECNIFKNFSRDTFNNI 840
            :.:.|||||.|.||.|...:...||..|.. |.:|:||......:|..|...|....|.|.:...
Zfish   647 ATLSHDLDHRGVNNSYIKRSDHPLAQLYCH-STMEHHHFDQCLMILNSPGNQILSGLSLDEYKAT 710

  Fly   841 REGIIRCILATDMARHNEILTQFMEI--TPIFDYSNRAHINLLCMILIKVADISNEARPMDVAEP 903
            .:.|.:.|||||:|.:.:..|:|.|:  ...|::.:..|.:||..:|:...|||...:|..|.:.
Zfish   711 LKMIEKAILATDLAVYMKKRTEFFELAKNSQFEWEDDCHRDLLRSMLMTACDISAITKPWPVQKK 775

  Fly   904 WLDRLLQEFFAQSAAEKSEGLPVTP--FMDPDKVSK-PGSQVRFIGLVLLPLFEAL 956
            ..:.:..|||.|...|:.| |.:.|  .|:.:|..| |..||.||..:...|:|||
Zfish   776 IAELVATEFFEQGDKERRE-LNIEPIDLMNREKQDKIPSMQVSFIDAICTQLYEAL 830

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde9NP_727644.3 PDEase_I 739..967 CDD:278654 75/223 (34%)
pde5abXP_005166620.1 GAF 163..323 CDD:214500
GAF 346..511 CDD:214500
PDEase_I 610..845 CDD:278654 75/223 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.