DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde9 and PDE6B

DIOPT Version :9

Sequence 1:NP_727644.3 Gene:Pde9 / 32233 FlyBaseID:FBgn0259171 Length:1623 Species:Drosophila melanogaster
Sequence 2:XP_011511775.1 Gene:PDE6B / 5158 HGNCID:8786 Length:941 Species:Homo sapiens


Alignment Length:329 Identity:93/329 - (28%)
Similarity:156/329 - (47%) Gaps:52/329 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   672 CDTTFSEEVRAALR--LP---AFDSYEW-------SDADVIHLMQTMFVELGFIEKFSIPVDTLR 724
            ||   .:|:...|:  ||   .||.||:       ::.|::.....|:.|||.:.||.||.:.|.
Human   553 CD---EDELGEILKEELPGPTTFDIYEFHFSDLECTELDLVKCGIQMYYELGVVRKFQIPQEVLV 614

  Fly   725 EWLYEVYKHYNEVPFHNFRHCFCVAQMMYAITRQANLLSRLGDLECLILLVSCICHDLDHPGYNN 789
            .:|:.:.|.|..:.:||:||.|.|||.|:.:.....|.|...|||...::.:.:|||:||.|.||
Human   615 RFLFSISKGYRRITYHNWRHGFNVAQTMFTLLMTGKLKSYYTDLEAFAMVTAGLCHDIDHRGTNN 679

  Fly   790 IYQINARTELALRYNDISPLENHHCSIAFRLLEHPECNIFKNFSRDTFNNIREGIIRCILATDMA 854
            :||:.::..|| :.:..|.||.||......||.....||::|.:|....::...:...|:|||:|
Human   680 LYQMKSQNPLA-KLHGSSILERHHLEFGKFLLSEETLNIYQNLNRRQHEHVIHLMDIAIIATDLA 743

  Fly   855 RHNEILTQFMEITPIFDYS-----NRAHINLLCM----------ILIKVADISNEARPMDVAEPW 904
            .:.:....|.:|.   |.|     .::.:..|.:          :::...|:|...:|.:|....
Human   744 LYFKKRAMFQKIV---DESKNYQDKKSWVEYLSLETTRKEIVMAMMMTACDLSAITKPWEVQSKV 805

  Fly   905 LDRLLQEFFAQSAAEKS--EGLPVTPFMDPDKVSK-PGSQVRFIGLV--------------LLPL 952
            ...:..||:.|...|::  :..|: |.||.:|.:: |..||.||..|              :||:
Human   806 ALLVAAEFWEQGDLERTVLDQQPI-PMMDRNKAAELPKLQVGFIDFVCTFVYKEFSRFHEEILPM 869

  Fly   953 FEAL 956
            |:.|
Human   870 FDRL 873

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde9NP_727644.3 PDEase_I 739..967 CDD:278654 70/250 (28%)
PDE6BXP_011511775.1 GAF 144..303 CDD:214500
GAF 325..512 CDD:214500
PDEase_I 629..874 CDD:278654 70/250 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.