DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde9 and PDE9A

DIOPT Version :9

Sequence 1:NP_727644.3 Gene:Pde9 / 32233 FlyBaseID:FBgn0259171 Length:1623 Species:Drosophila melanogaster
Sequence 2:NP_002597.1 Gene:PDE9A / 5152 HGNCID:8795 Length:593 Species:Homo sapiens


Alignment Length:394 Identity:187/394 - (47%)
Similarity:245/394 - (62%) Gaps:25/394 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   628 DLKRKVE----YTERMNWLCL-----SKRPLGPPHRKSSLPKHQEVKRRFLEICDTTFSEEVRAA 683
            |:|:..|    .:.|.|..|.     :.:.|.|.....:.||:             ..|.|...|
Human   204 DIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKY-------------LLSPETIEA 255

  Fly   684 LRLPAFDSYEWSDADVIHLMQTMFVELGFIEKFSIPVDTLREWLYEVYKHYNEVPFHNFRHCFCV 748
            ||.|.||.:.|...:::..::.|:.:||.:..|||...|||.||:.|:.:|...|||||||||||
Human   256 LRKPTFDVWLWEPNEMLSCLEHMYHDLGLVRDFSINPVTLRRWLFCVHDNYRNNPFHNFRHCFCV 320

  Fly   749 AQMMYAITRQANLLSRLGDLECLILLVSCICHDLDHPGYNNIYQINARTELALRYNDISPLENHH 813
            |||||::....:|..:....:.|||:.:.||||||||||||.||||||||||:||||||||||||
Human   321 AQMMYSMVWLCSLQEKFSQTDILILMTAAICHDLDHPGYNNTYQINARTELAVRYNDISPLENHH 385

  Fly   814 CSIAFRLLEHPECNIFKNFSRDTFNNIREGIIRCILATDMARHNEILTQFMEITPIFDYSNRAHI 878
            |::||::|..||||||.|...|.|..||:|:|..|||||||||.||:..|.|....|||||..|:
Human   386 CAVAFQILAEPECNIFSNIPPDGFKQIRQGMITLILATDMARHAEIMDSFKEKMENFDYSNEEHM 450

  Fly   879 NLLCMILIKVADISNEARPMDVAEPWLDRLLQEFFAQSAAEKSEGLPVTPFMDPDKVSKPGSQVR 943
            .||.|||||..|||||.|||:|||||:|.||:|:|.||..||||||||.||||.|||:|..:|:.
Human   451 TLLKMILIKCCDISNEVRPMEVAEPWVDCLLEEYFMQSDREKSEGLPVAPFMDRDKVTKATAQIG 515

  Fly   944 FIGLVLLPLFEALGELVPELTELIIIPV---RIALEYYRRLNDAQTKTRKSVADSNTSATSDSNS 1005
            ||..||:|:||.:.:|.|.:.|:::.|:   |...|..:|::||..:.:|......:.||..|..
Human   516 FIKFVLIPMFETVTKLFPMVEEIMLQPLWESRDRYEELKRIDDAMKELQKKTDSLTSGATEKSRE 580

  Fly  1006 GTID 1009
            .:.|
Human   581 RSRD 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde9NP_727644.3 PDEase_I 739..967 CDD:278654 143/227 (63%)
PDE9ANP_002597.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..141
PDEase_I 311..539 CDD:278654 143/227 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 564..593 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 302 1.000 Domainoid score I1408
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 1 1.000 - - FOG0004612
OrthoInspector 1 1.000 - - oto89712
orthoMCL 1 0.900 - - OOG6_103870
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2223
SonicParanoid 1 1.000 - - X3819
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.