DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde9 and PDE8A

DIOPT Version :9

Sequence 1:NP_727644.3 Gene:Pde9 / 32233 FlyBaseID:FBgn0259171 Length:1623 Species:Drosophila melanogaster
Sequence 2:NP_002596.1 Gene:PDE8A / 5151 HGNCID:8793 Length:829 Species:Homo sapiens


Alignment Length:558 Identity:143/558 - (25%)
Similarity:230/558 - (41%) Gaps:141/558 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   467 NPRRRRASDCSAVQAALQNQLHCITLKNNNCGKAMPFHRGSCGAAGEHLLAANSIANRATIILSK 531
            |.:..:.|:|      :|:..|    .:|..||.....:||        |...::|:|||.:.|:
Human   329 NNKAEKISEC------VQSDTH----TDNQTGKHKDRRKGS--------LDVKAVASRATEVSSQ 375

  Fly   532 SCSNVDGDATATAATALSSTVGGGIGGIGGSIKMRASATDIE-TNALN----------------G 579
            .       ..::.|...|.|:...|..:...|.....::.:. |.||:                |
Human   376 R-------RHSSMARIHSMTIEAPITKVINIINAAQESSPMPVTEALDRVLEILRTTELYSPQFG 433

  Fly   580 ARDAIVASNN--GNNGNNG--NNGNNEYSILQLNNTIIQCH----FNDDDFRALVKDLKRKVEYT 636
            |:|....:|:  |...::|  ....|||.:...|..::..:    .:.||....:.......||.
Human   434 AKDDDPHANDLVGGLMSDGLRRLSGNEYVLSTKNTQMVSSNIITPISLDDVPPRIARAMENEEYW 498

  Fly   637 ERMNWLCLSKRPLGPPHRKSSLPKHQEVKRRFLEICDTTFSEEVRAALRLPAFDSYEWSDA---- 697
            :                                                   ||.:|...|    
Human   499 D---------------------------------------------------FDIFELEAATHNR 512

  Fly   698 DVIHLMQTMFVELGFIEKFSIPVDTLREWLYEVYKHYNEV-PFHNFRHCFCVAQMMYAITRQANL 761
            .:|:|...||...|..|.......|||.||..:..:|:.. |:||..|.   |.:::|   .|..
Human   513 PLIYLGLKMFARFGICEFLHCSESTLRSWLQIIEANYHSSNPYHNSTHS---ADVLHA---TAYF 571

  Fly   762 LSR------LGDLECLILLVSCICHDLDHPGYNNIYQINARTELALRYNDISPLENHHCSIAFRL 820
            ||:      |..::.:..|::...||:||||..|.:..||.:|||:.|||.:.||:||.::||:|
Human   572 LSKERIKETLDPIDEVAALIAATIHDVDHPGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQL 636

  Fly   821 LE-HPECNIFKNFSRDTFNNIREGIIRCILATDMARHNEILTQFMEI--TPIFDY-------SNR 875
            .. ..:||||||..|:.:..:|:|||..:|||:|.:|.|.:.:|:..  .|:...       .|:
Human   637 TTGDDKCNIFKNMERNDYRTLRQGIIDMVLATEMTKHFEHVNKFVNSINKPLATLEENGETDKNQ 701

  Fly   876 AHIN----------LLCMILIKVADISNEARPMDVAEPWLDRLLQEFFAQSAAEKSEGLPVT-PF 929
            ..||          |:..:|||.||:||..||:.....|..|:.:|:|:|:..||.:||||. |.
Human   702 EVINTMLRTPENRTLIKRMLIKCADVSNPCRPLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPV 766

  Fly   930 MDPDKVSKPGSQVRFIGLVLLPLFEALGELV--PELTE 965
            .|.:..|.|.||:.||...:..:|:|....|  |:|.:
Human   767 FDRNTCSIPKSQISFIDYFITDMFDAWDAFVDLPDLMQ 804

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde9NP_727644.3 PDEase_I 739..967 CDD:278654 88/256 (34%)
PDE8ANP_002596.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..46
OmpR 82..>159 CDD:223816
REC 83..>170 CDD:302758
PAS_9 226..324 CDD:290162
PAS 230..324 CDD:238075
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 341..360 6/30 (20%)
Involved in RAF1-binding. /evidence=ECO:0000269|PubMed:23509299 454..461 1/6 (17%)
PDEase_I 555..807 CDD:278654 88/256 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2223
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.