DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde9 and PDE7A

DIOPT Version :9

Sequence 1:NP_727644.3 Gene:Pde9 / 32233 FlyBaseID:FBgn0259171 Length:1623 Species:Drosophila melanogaster
Sequence 2:NP_001229247.1 Gene:PDE7A / 5150 HGNCID:8791 Length:482 Species:Homo sapiens


Alignment Length:350 Identity:97/350 - (27%)
Similarity:160/350 - (45%) Gaps:23/350 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   669 LEICDTTFSEEVRAALRLPA---FDSYEW----SDADVIHLMQTMFVELGFIEKFSIPVDTLREW 726
            |.|.|..::.:.:..|....   ||.:.:    :...::.|...:|...|.||.|.:.:..||.:
Human   133 LNILDDDYNGQAKCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMMKLRRF 197

  Fly   727 LYEVYKHY-NEVPFHNFRHCFCVAQMMYAITRQANLLSRLGDLECLILLVSCICHDLDHPGYNNI 790
            |..:.:.| ::.|:||..|...|.|.|:...::..|.:.:...:.|:.|::...|||||||.|..
Human   198 LVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLANSVTPWDILLSLIAAATHDLDHPGVNQP 262

  Fly   791 YQINARTELALRYNDISPLENHHCSIAFRLLEHPECNIFKNFSRDTFNNIREGIIRCILATDMAR 855
            :.|.....||..|.:.|.|||||...|..||.  |..:|.:...::...:...|...|||||::|
Human   263 FLIKTNHYLATLYKNTSVLENHHWRSAVGLLR--ESGLFSHLPLESRQQMETQIGALILATDISR 325

  Fly   856 HNEILTQFMEITPIFD--YSNRAHINLLCMILIKVADISNEARPMDVAEPWLDRLLQEFFAQSAA 918
            .||.|:.|.......|  ..:..|.:|:..:.:|.|||.|..|..::::.|.:::.:|||.|...
Human   326 QNEYLSLFRSHLDRGDLCLEDTRHRHLVLQMALKCADICNPCRTWELSKQWSEKVTEEFFHQGDI 390

  Fly   919 EKSEGLPVTPFMDPDKVSKPGSQVRFIGLVLLPLFEALGELV-PELTELIIIPVRIALEYYRRLN 982
            ||...|.|:|..|....|....|:.|:..::.|||....... ..|::.::..|        .||
Human   391 EKKYHLGVSPLCDRHTESIANIQIGFMTYLVEPLFTEWARFSNTRLSQTMLGHV--------GLN 447

  Fly   983 DAQTK--TRKSVADSNTSATSDSNS 1005
            .|..|  .|:..:..:|.|..:.||
Human   448 KASWKGLQREQSSSEDTDAAFELNS 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde9NP_727644.3 PDEase_I 739..967 CDD:278654 70/230 (30%)
PDE7ANP_001229247.1 PDEase_I 211..444 CDD:395177 70/234 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.