DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde9 and PDE6A

DIOPT Version :9

Sequence 1:NP_727644.3 Gene:Pde9 / 32233 FlyBaseID:FBgn0259171 Length:1623 Species:Drosophila melanogaster
Sequence 2:NP_000431.2 Gene:PDE6A / 5145 HGNCID:8785 Length:860 Species:Homo sapiens


Alignment Length:456 Identity:118/456 - (25%)
Similarity:193/456 - (42%) Gaps:88/456 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   636 TERMNWLCLSKRPLGPPHRKSSLPKHQEVKRRFLEI------CDTTFSEEVRAALR--------- 685
            |:.:.|..|:      |....|:.|.:..|..|.:|      ||   :||::..|:         
Human   424 TQFLGWSVLN------PDTYESMNKLENRKDIFQDIVKYHVKCD---NEEIQKILKTREVYGKEP 479

  Fly   686 ---------------LPAFDSYE-----WSDADVIHLMQT-----MFVELGFIEKFSIPVDTLRE 725
                           ||..|.||     :||..:..|...     |:.||..::||.||.:.|..
Human   480 WECEEEELAEILQAELPDADKYEINKFHFSDLPLTELELVKCGIQMYYELKVVDKFHIPQEALVR 544

  Fly   726 WLYEVYKHYNEVPFHNFRHCFCVAQMMYAITRQANLLSRLGDLECLILLVSCICHDLDHPGYNNI 790
            ::|.:.|.|.::.:||:||.|.|.|.|:::.....|.....|||.|.::.:..|||:||.|.||:
Human   545 FMYSLSKGYRKITYHNWRHGFNVGQTMFSLLVTGKLKRYFTDLEALAMVTAAFCHDIDHRGTNNL 609

  Fly   791 YQINARTELALRYNDISPLENHHCSIAFRLLEHPECNIFKNFSRDTFNNIREGIIRCILATDMAR 855
            ||:.::..|| :.:..|.||.||......||.....|||:|.:|....:....:...|:|||:|.
Human   610 YQMKSQNPLA-KLHGSSILERHHLEFGKTLLRDESLNIFQNLNRRQHEHAIHMMDIAIIATDLAL 673

  Fly   856 HNEILTQFMEITPIFDYS---------------NRAHINLLCMILIKVADISNEARPMDVAEPWL 905
            :.:..|.|.:|.   |.|               .:....::..:::...|:|...:|.:|.....
Human   674 YFKKRTMFQKIV---DQSKTYESEQEWTQYMMLEQTRKEIVMAMMMTACDLSAITKPWEVQSQVA 735

  Fly   906 DRLLQEFFAQSAAEKS--EGLPVTPFMDPDKVSK-PGSQVRFIGLVLLPLFEALGELVPELTELI 967
            ..:..||:.|...|::  :..|: |.||.:|..: |..||.||..|...:::.......|:|.::
Human   736 LLVAAEFWEQGDLERTVLQQNPI-PMMDRNKADELPKLQVGFIDFVCTFVYKEFSRFHEEITPML 799

  Fly   968 --IIPVR-----IALEYYRRLNDAQTKTRKSVADSNTSATSDSNSGTIDSNAAMVSTPGGASDKL 1025
              |...|     :|.||     ||:.|.::.......||.|.:.......|    .:||||:...
Human   800 DGITNNRKEWKALADEY-----DAKMKVQEEKKQKQQSAKSAAAGNQPGGN----PSPGGATTSK 855

  Fly  1026 S 1026
            |
Human   856 S 856

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde9NP_727644.3 PDEase_I 739..967 CDD:278654 68/245 (28%)
PDE6ANP_000431.2 GAF 75..232 CDD:214500
GAF 254..441 CDD:214500 5/22 (23%)
PDEase_I 558..802 CDD:365964 68/248 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 821..860 10/40 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.