DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde9 and PDE4D

DIOPT Version :9

Sequence 1:NP_727644.3 Gene:Pde9 / 32233 FlyBaseID:FBgn0259171 Length:1623 Species:Drosophila melanogaster
Sequence 2:NP_001098101.1 Gene:PDE4D / 5144 HGNCID:8783 Length:809 Species:Homo sapiens


Alignment Length:359 Identity:108/359 - (30%)
Similarity:172/359 - (47%) Gaps:55/359 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   702 LMQTMFVELGFIEKFSIPVDTLREWLYEVYKHYN-EVPFHNFRHCFCVAQMMYAITRQANLLSRL 765
            :|.|:|.|...::.|.||||||..:|..:..||: :|.:||..|...|.|..:.:.....|.:..
Human   423 IMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVF 487

  Fly   766 GDLECLILLVSCICHDLDHPGYNNIYQINARTELALRYNDISPLENHHCSIAFRLLEHPECNIFK 830
            .|||.|..:.:...||:||||.:|.:.||..:||||.|||.|.|||||.::.|:||:...|:||:
Human   488 TDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQ 552

  Fly   831 NFSRDTFNNIREGIIRCILATDMARHNEILTQFMEITP-----------IFDYSNRAHINLLCMI 884
            |.::....::|:.:|..:|||||::|..:|.....:..           :.:||:|..:   ...
Human   553 NLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQV---LQN 614

  Fly   885 LIKVADISNEARPMDVAEPWLDRLLQEFFAQSAAEKSEGLPVTPFMDPDKVSKPGSQVRFIGLVL 949
            ::..||:||..:|:.:...|.||:::|||.|...|:..|:.::|..|....|...|||.||..::
Human   615 MVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIV 679

  Fly   950 LPLFEALGELVPELTELIIIPVRIALEYYRRL------------------------------NDA 984
            .||:|...:||....:.|:..:....|:|:..                              .|.
Human   680 HPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAPDDPEEGRQGQTEKFQFELTLEEDG 744

  Fly   985 QTKTRK----------SVADSNTSATSDSNSGTI 1008
            ::.|.|          |.:||.|..|.||.|..|
Human   745 ESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEI 778

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde9NP_727644.3 PDEase_I 739..967 CDD:278654 78/238 (33%)
PDE4DNP_001098101.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..107
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 343..364
PDEase_I 461..702 CDD:278654 79/243 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 710..729 0/18 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 739..809 12/40 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.