DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde9 and PDE3B

DIOPT Version :9

Sequence 1:NP_727644.3 Gene:Pde9 / 32233 FlyBaseID:FBgn0259171 Length:1623 Species:Drosophila melanogaster
Sequence 2:NP_001350499.1 Gene:PDE3B / 5140 HGNCID:8779 Length:1190 Species:Homo sapiens


Alignment Length:819 Identity:162/819 - (19%)
Similarity:279/819 - (34%) Gaps:257/819 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 VEQPATSGTTNIH--LQPTSLPDGSDNPRRRRASDCSAVQAALQNQLHCITLKNNNCGK------ 499
            :|.||..|...::  |...|||    .|:.||:|..|.:....|:     :..:.|.||      
Human   491 IEDPAEKGDRKLNKGLNRNSLP----TPQLRRSSGTSGLLPVEQS-----SRWDRNNGKRPHQEF 546

  Fly   500 ------------------AMPFHRGSCGAAGEHL---------------------LAANSIANRA 525
                              .:|..|.|..:...|:                     ::..|:.|| 
Human   547 GISSQGCYLNGPFNSNLLTIPKQRSSSVSLTHHVGLRRAGVLSSLSPVNSSNHGPVSTGSLTNR- 610

  Fly   526 TIILSKSCSNVDGDATATAATALSSTVGGGIGGIGGSIKMRASATDIETNALNGARDAIV----- 585
                    |.::...||......|..:...:|....:........:.::|..|.....::     
Human   611 --------SPIEFPDTADFLNKPSVILQRSLGNAPNTPDFYQQLRNSDSNLCNSCGHQMLKYVST 667

  Fly   586 ASNNGNNGNNGNNGNNEYSILQLNNTIIQCHFNDDDFRALVKDLKRKVE-------YTERMNWLC 643
            :.::|.:..:|.:|..|..            |:.:.|:.:....:.:.|       :.|...||.
Human   668 SESDGTDCCSGKSGEEENI------------FSKESFKLMETQQEEETEKKDSRKLFQEGDKWLT 720

  Fly   644 LSKRPLGPPHRKSSLPKHQEVKRRFLEICDTTFSEEVRAALRLPAFDSY----EWSDADVIHLMQ 704
            ...:    ..:::::  .|||....:.:.:.....|..:....|.|:..    |.|...:..:|.
Human   721 EEAQ----SEQQTNI--EQEVSLDLILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVMY 779

  Fly   705 TMFVELGFIEKFSIPVDTLREWLYEVYKHYNEVPFHNFRHCFCVAQMMYAITRQ----------- 758
            |:|.:.|.:|.|.||......:...:...|.::|:||..|...|...::.:|.:           
Human   780 TLFQDTGLLEIFKIPTQQFMNYFRALENGYRDIPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNG 844

  Fly   759 --------------------------AN-------LLSRLGDLECLILLVSCICHDLDHPGYNNI 790
                                      :|       |.|.:..||.:.|.|:...||.||||..|.
Human   845 CGTGNETDSDGRINHGRIAYISSKSCSNPDESYGCLSSNIPALELMALYVAAAMHDYDHPGRTNA 909

  Fly   791 YQINARTELALRYNDISPLENHHCSIAFRL-LEHPECNIFKNFSRDTFNNIREGIIRCILATDMA 854
            :.:......|:.|||.|.|||||.:.|:.| |..||.|...:.....|...|..:|..|||||:.
Human   910 FLVATNAPQAVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILATDLK 974

  Fly   855 RHNEILTQF-MEITPI----FDYSNRAHINLLCMILIKVADISNEARPMDVAEPWLDRLLQEFFA 914
            :|.:.|.:| .:...:    .::||.....|:|.:.||:|||:..|:..|:...|.:.::.||:.
Human   975 KHFDFLAEFNAKANDVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFYE 1039

  Fly   915 QSAAEKSEGLPVTPFMDPDKVSKPGSQVRFIGLVLLPL---FEALGELVPELTELIIIPVRIALE 976
            |...|.:.|||::||||.........|..||..::.||   ::|.|.|..:..|           
Human  1040 QGDEEANLGLPISPFMDRSSPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWLE----------- 1093

  Fly   977 YYRRLNDAQTKTRKSVADSNTSATSDSNSGTIDSNAAMVSTPGGASDKLSLDKGQGNSQGSGGGG 1041
                          :..|::|.:..|.:...:|:.                |:...|        
Human  1094 --------------AEEDNDTESGDDEDGEELDTE----------------DEEMEN-------- 1120

  Fly  1042 GGGGGGGAGGGTGSGCGSNAAGSVSPQMPRSGSGISVKSRRSIPSQKSASRTSVDEPGGMASELH 1106
                                  :::|:.||.      ||||.|..|.                :|
Human  1121 ----------------------NLNPKPPRR------KSRRRIFCQL----------------MH 1141

  Fly  1107 DLPEGSESGDSETATEVDVAEKTSKFKVD-----TEGSS 1140
            .|.|..:...       ::.|:..|.|.|     .|.||
Human  1142 HLTENHKIWK-------EIVEEEEKCKADGNKLQVENSS 1173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde9NP_727644.3 PDEase_I 739..967 CDD:278654 78/280 (28%)
PDE3BNP_001350499.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
Interaction with RAPGEF3. /evidence=ECO:0000269|PubMed:21393242 1..25
DUF1109 136..>282 CDD:310850
PDEase_I 814..1088 CDD:306695 76/273 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.