DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde9 and PDE7B

DIOPT Version :9

Sequence 1:NP_727644.3 Gene:Pde9 / 32233 FlyBaseID:FBgn0259171 Length:1623 Species:Drosophila melanogaster
Sequence 2:NP_061818.1 Gene:PDE7B / 27115 HGNCID:8792 Length:450 Species:Homo sapiens


Alignment Length:366 Identity:93/366 - (25%)
Similarity:153/366 - (41%) Gaps:71/366 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   699 VIHLMQTMFVELGFIEKFSIPVDTLREWLYEVYKHY-NEVPFHNFRHCFCVAQMMYAITRQANLL 762
            ::.|:..:|...|.|..|.:.:.||..:|..|.:.| ::.|:||..|...|.|.|:...::..|.
Human   131 LVTLLCHLFNTHGLIHHFKLDMVTLHRFLVMVQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLA 195

  Fly   763 SRLGDLECLILLVSCICHDLDHPGYNNIYQINARTELALRYNDISPLENHHCSIAFRLLEHPECN 827
            |.|..|:.::.|::...||:||||.|..:.|.....||..|.::|.|||||......:|.  |..
Human   196 SFLTPLDIMLGLLAAAAHDVDHPGVNQPFLIKTNHHLANLYQNMSVLENHHWRSTIGMLR--ESR 258

  Fly   828 IFKNFSRDTFNNIREGIIRCILATDMARHNEILTQFMEITPIFDYSNRAHI-------------N 879
            :..:..::...:|.:.:...|||||:.|.||.||:.           :||:             :
Human   259 LLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRL-----------KAHLHNKDLRLEDAQDRH 312

  Fly   880 LLCMILIKVADISNEARPMDVAEPWLDRLLQEFFAQSAAEKSEGLPVTPFMDPDKVSKPGSQVRF 944
            .:..|.:|.|||.|..|..::::.|.:|:.:||:.|...|:...|.::|..:..|.|.|..|:.|
Human   313 FMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGELEQKFELEISPLCNQQKDSIPSIQIGF 377

  Fly   945 IGLVLLPLFEALGELVPELTELIIIPVRIALEYYRRLNDAQTKTRKSVADSNTSATSDSNSGTID 1009
            :..::.|||                                   |:....:..|..|::..|.:.
Human   378 MSYIVEPLF-----------------------------------REWAHFTGNSTLSENMLGHLA 407

  Fly  1010 SNAAMVSTPGGASDKLSLDKGQGNSQGSGGGGGGGGGGGAG 1050
            .|.|...         ||...|..|:||.|.|......|.|
Human   408 HNKAQWK---------SLLPRQHRSRGSSGSGPDHDHAGQG 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde9NP_727644.3 PDEase_I 739..967 CDD:278654 66/240 (28%)
PDE7BNP_061818.1 PDEase_I 172..392 CDD:278654 67/267 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 418..450 8/22 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.