DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde9 and Pde4b

DIOPT Version :9

Sequence 1:NP_727644.3 Gene:Pde9 / 32233 FlyBaseID:FBgn0259171 Length:1623 Species:Drosophila melanogaster
Sequence 2:XP_038965199.1 Gene:Pde4b / 24626 RGDID:3280 Length:736 Species:Rattus norvegicus


Alignment Length:279 Identity:88/279 - (31%)
Similarity:150/279 - (53%) Gaps:16/279 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   702 LMQTMFVELGFIEKFSIPVDTLREWLYEVYKHY-NEVPFHNFRHCFCVAQMMYAITRQANLLSRL 765
            :|..:|.|...::.|.|..||...::..:..|| ::|.:||..|...|||..:.:.....|.:..
  Rat   367 IMYAIFQERDLLKTFKISSDTFVTYMMTLEDHYHSDVAYHNSLHAADVAQSTHVLLSTPALDAVF 431

  Fly   766 GDLECLILLVSCICHDLDHPGYNNIYQINARTELALRYNDISPLENHHCSIAFRLLEHPECNIFK 830
            .|||.|..:.:...||:||||.:|.:.||..:||||.|||.|.|||||.::.|:||:...|:||:
  Rat   432 TDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEEHCDIFQ 496

  Fly   831 NFSRDTFNNIREGIIRCILATDMARHNEILTQFMEITP-----------IFDYSNRAHINLLCMI 884
            |.::.....:|:.:|..:|||||::|..:|.....:..           :.:|::|..:   ...
  Rat   497 NLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTSSGVLLLDNYTDRIQV---LRN 558

  Fly   885 LIKVADISNEARPMDVAEPWLDRLLQEFFAQSAAEKSEGLPVTPFMDPDKVSKPGSQVRFIGLVL 949
            ::..||:||..:.:::...|.||:::|||.|...|:..|:.::|..|....|...|||.||..::
  Rat   559 MVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEISPMCDKHTASVEKSQVGFIDYIV 623

  Fly   950 LPLFEALGELV-PELTELI 967
            .||:|...:|| |:..:::
  Rat   624 HPLWETWADLVQPDAQDIL 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde9NP_727644.3 PDEase_I 739..967 CDD:278654 78/239 (33%)
Pde4bXP_038965199.1 PDE4_UCR 166..281 CDD:407935
PDEase_I 405..646 CDD:395177 78/241 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.