DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde9 and Pde6b

DIOPT Version :9

Sequence 1:NP_727644.3 Gene:Pde9 / 32233 FlyBaseID:FBgn0259171 Length:1623 Species:Drosophila melanogaster
Sequence 2:NP_032832.2 Gene:Pde6b / 18587 MGIID:97525 Length:856 Species:Mus musculus


Alignment Length:307 Identity:90/307 - (29%)
Similarity:150/307 - (48%) Gaps:44/307 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   689 FDSYEWSDADV----IHLMQ---TMFVELGFIEKFSIPVDTLREWLYEVYKHYNEVPFHNFRHCF 746
            ||.||:..:|:    :.|::   .|:.|||.:.||.||.:.|..:|:.|.|.|..:.:||:||.|
Mouse   499 FDIYEFHFSDLECTELELVKCGIQMYYELGVVRKFQIPQEVLVRFLFSVSKAYRRITYHNWRHGF 563

  Fly   747 CVAQMMYAITRQANLLSRLGDLECLILLVSCICHDLDHPGYNNIYQINARTELALRYNDISPLEN 811
            .|||.|:.:.....|.|...|||...::.:.:|||:||.|.||:||:.::..|| :.:..|.||.
Mouse   564 NVAQTMFTLLMTGKLKSYYTDLEAFAMVTAGLCHDIDHRGTNNLYQMKSQNPLA-KLHGSSILER 627

  Fly   812 HHCSIAFRLLEHPECNIFKNFSRDTFNNIREGIIRCILATDMARHNEILTQFMEITPIFDYS--- 873
            ||......||.....||::|.:|....::...:...|:|||:|.:.:..|.|.:|.   |.|   
Mouse   628 HHLEFGKFLLAEESLNIYQNLNRRQHEHVIHLMDIAIIATDLALYFKKRTMFQKIV---DESKNY 689

  Fly   874 --NRAHINLLCM----------ILIKVADISNEARPMDVAEPWLDRLLQEFFAQSAAEKS--EGL 924
              .::.:..|.:          :::...|:|...:|.:|.......:..||:.|...|::  :..
Mouse   690 EDKKSWVEYLSLETTRKEIVMAMMMTACDLSAITKPWEVQSKVALLVAAEFWEQGDLERTVLDQQ 754

  Fly   925 PVTPFMDPDKVSK-PGSQVRFIGLV--------------LLPLFEAL 956
            |: |.||.:|.:: |..||.||..|              :||:|:.|
Mouse   755 PI-PMMDRNKAAELPKLQVGFIDFVCTFVYKEFSRFHEEILPMFDRL 800

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde9NP_727644.3 PDEase_I 739..967 CDD:278654 71/250 (28%)
Pde6bNP_032832.2 GAF 71..230 CDD:214500
GAF 252..439 CDD:214500
PDEase_I 556..801 CDD:278654 71/250 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.