DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde9 and Pde7a

DIOPT Version :9

Sequence 1:NP_727644.3 Gene:Pde9 / 32233 FlyBaseID:FBgn0259171 Length:1623 Species:Drosophila melanogaster
Sequence 2:NP_001116231.1 Gene:Pde7a / 18583 MGIID:1202402 Length:482 Species:Mus musculus


Alignment Length:295 Identity:87/295 - (29%)
Similarity:142/295 - (48%) Gaps:12/295 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   669 LEICDTTFSEEVRAALRLPA---FDSYEW----SDADVIHLMQTMFVELGFIEKFSIPVDTLREW 726
            |:|.|..::.:.:..|....   ||.:.:    :...::.|...:|...|.||.|.:.:..||.:
Mouse   133 LDILDEDYNGQAKCMLEKVGNWNFDIFLFDRLTNGNSLVSLTFHLFSLHGLIEYFHLDMVKLRRF 197

  Fly   727 LYEVYKHY-NEVPFHNFRHCFCVAQMMYAITRQANLLSRLGDLECLILLVSCICHDLDHPGYNNI 790
            |..:.:.| ::.|:||..|...|.|.|:...::..|.|.:...:.|:.|::...|||||||.|..
Mouse   198 LVMIQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLASSVTPWDILLSLIAAATHDLDHPGVNQP 262

  Fly   791 YQINARTELALRYNDISPLENHHCSIAFRLLEHPECNIFKNFSRDTFNNIREGIIRCILATDMAR 855
            :.|.....||..|.:.|.|||||...|..||.  |..:|.:...::...:...|...|||||::|
Mouse   263 FLIKTNHYLATLYKNSSVLENHHWRSAVGLLR--ESGLFSHLPLESRQEMEAQIGALILATDISR 325

  Fly   856 HNEILTQFMEITPIFD--YSNRAHINLLCMILIKVADISNEARPMDVAEPWLDRLLQEFFAQSAA 918
            .||.|:.|.......|  ..:..|.:|:..:.:|.|||.|..|..::::.|.:::.:|||.|...
Mouse   326 QNEYLSLFRSHLDKGDLHLDDGRHRHLVLQMALKCADICNPCRNWELSKQWSEKVTEEFFHQGDI 390

  Fly   919 EKSEGLPVTPFMDPDKVSKPGSQVRFIGLVLLPLF 953
            ||...|.|:|..|....|....|:.|:..::.|||
Mouse   391 EKKYHLGVSPLCDRQTESIANIQIGFMTYLVEPLF 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde9NP_727644.3 PDEase_I 739..967 CDD:278654 70/217 (32%)
Pde7aNP_001116231.1 Endonuc-BglII <51..128 CDD:286304
PDEase_I 211..431 CDD:278654 70/217 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.