DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde9 and pde-5

DIOPT Version :9

Sequence 1:NP_727644.3 Gene:Pde9 / 32233 FlyBaseID:FBgn0259171 Length:1623 Species:Drosophila melanogaster
Sequence 2:NP_491544.3 Gene:pde-5 / 183125 WormBaseID:WBGene00016328 Length:728 Species:Caenorhabditis elegans


Alignment Length:359 Identity:97/359 - (27%)
Similarity:157/359 - (43%) Gaps:53/359 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   660 KHQEVKRRFLEICDTTFSEEVRAALRLPAFDSYEWSDADVIHLMQTMFVELGFIEKFSIPVDTLR 724
            |..|:..|.:|:....|:....:.|..|.:         .:::.:|:|            .||||
 Worm   399 KKIEINNRIVELETIDFNGMRLSELEKPLY---------AVYMFKTLF------------ADTLR 442

  Fly   725 -------EWLYEVYKHYNEVPFHNFRHCFCVAQMMYAITRQANLLSRLGDLECLILLVSCICHDL 782
                   .::..|.|:|..|.:||:.|.:.||..|:|..  .|.......||.|.|.|||:||||
 Worm   443 FDTEDLIRFVLTVRKNYRRVAYHNWAHGWSVAHAMFATL--MNSPDAFTKLEALALYVSCLCHDL 505

  Fly   783 DHPGYNNIYQINARTELALRYNDISPLENHHCSIAFRLLEHPECNIFKNFSRDTFNNIREGIIRC 847
            ||.|.||.|.....|.||..|: .|.:|.||.:....:|:....||.|:.|.:.:......|..|
 Worm   506 DHRGKNNAYMKTMSTPLASIYS-TSVMERHHFNQTVTILQQDGHNILKSLSSEDYKKTLSLIKHC 569

  Fly   848 ILATDM-------ARHNEILTQFMEITPIFDYSNRAHINLLCMILIKVADISNEARPMDVAEPWL 905
            |||||:       |:.|.||.     ...||.:.:.|..|...:::...|:...|:|.::....:
 Worm   570 ILATDLALFFSNKAKLNVILD-----NNTFDINRQEHRLLTQAVMMTGCDLVASAKPWNIQTETV 629

  Fly   906 DRLLQEFFAQSAAEKSEGLPVTPFMDPDKVSK-PGSQVRFIGLVLLPLFEALGELVPELTELIII 969
            ..:.:||:.|..||:..|....|.||..:... |..||.|:..:.:|.::.:..:.|:..::   
 Worm   630 KVIFEEFYDQGDAERLSGKEPIPMMDRQQAHMLPQMQVGFMRGICMPCYDLIARIFPKNDKM--- 691

  Fly   970 PVRIALEY----YRRLNDAQTKTRKSVADSNTSA 999
              |...||    :..|.:.|.|.::::|..|..|
 Worm   692 --RERCEYNAKKWEELAEEQRKKQEALAQQNGEA 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde9NP_727644.3 PDEase_I 739..967 CDD:278654 71/235 (30%)
pde-5NP_491544.3 GAF 221..371 CDD:214500
PDEase_I 464..696 CDD:278654 72/244 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.