DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde9 and Pde7b

DIOPT Version :9

Sequence 1:NP_727644.3 Gene:Pde9 / 32233 FlyBaseID:FBgn0259171 Length:1623 Species:Drosophila melanogaster
Sequence 2:XP_008756813.1 Gene:Pde7b / 140929 RGDID:621016 Length:498 Species:Rattus norvegicus


Alignment Length:269 Identity:77/269 - (28%)
Similarity:130/269 - (48%) Gaps:27/269 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   699 VIHLMQTMFVELGFIEKFSIPVDTLREWLYEVYKHYN-EVPFHNFRHCFCVAQMMYAITRQANLL 762
            ::.|:..:|...|.|..|.:.:.||..:|..|.:.|: ..|:||..|...|.|.|:...::..|.
  Rat   183 LVTLLCHLFNSHGLIHHFKLDMVTLHRFLVMVQEDYHGHNPYHNAVHAADVTQAMHCYLKEPKLA 247

  Fly   763 SRLGDLECLILLVSCICHDLDHPGYNNIYQINARTELALRYNDISPLENHHCSIAFRLLEHPECN 827
            |.|..|:.::.|::...||:||||.|..:.|.....||..|.::|.|||||......:|.  |..
  Rat   248 SFLTPLDIMLGLLAAAAHDVDHPGVNQPFLIKTNHHLANLYQNMSVLENHHWRSTIGMLR--ESR 310

  Fly   828 IFKNFSRDTFNNIREGIIRCILATDMARHNEILTQFMEITPIFDYSNRAHI-------------N 879
            :..:..::...:|.:.:...|||||:.|.||.||:.           :||:             :
  Rat   311 LLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRL-----------KAHLHNKDLRLENIQDRH 364

  Fly   880 LLCMILIKVADISNEARPMDVAEPWLDRLLQEFFAQSAAEKSEGLPVTPFMDPDKVSKPGSQVRF 944
            .:..|.:|.|||.|..|..::::.|.:|:.:||:.|...|:...|.::|..:..|.|.|..|:.|
  Rat   365 FMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGDLEQKFELEISPLCNQQKDSIPSIQIGF 429

  Fly   945 IGLVLLPLF 953
            :..::.|||
  Rat   430 MTYIVEPLF 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde9NP_727644.3 PDEase_I 739..967 CDD:278654 66/228 (29%)
Pde7bXP_008756813.1 PDEase_I 224..458 CDD:278654 66/228 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.