DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde9 and PDE10A

DIOPT Version :9

Sequence 1:NP_727644.3 Gene:Pde9 / 32233 FlyBaseID:FBgn0259171 Length:1623 Species:Drosophila melanogaster
Sequence 2:NP_001372008.1 Gene:PDE10A / 10846 HGNCID:8772 Length:1055 Species:Homo sapiens


Alignment Length:290 Identity:86/290 - (29%)
Similarity:145/290 - (50%) Gaps:12/290 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   720 VDTLREWLYEVYKHYNEVPFHNFRHCFCVAQMMYAITRQANLLSRLGDLECLILLVSCICHDLDH 784
            ::.|..::..|.|:|..||:||::|...||..||||.:..:.|  ..|||...||::|:||||||
Human   771 LEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHTL--FTDLERKGLLIACLCHDLDH 833

  Fly   785 PGYNNIYQINARTELALRYNDISPLENHHCSIAFRLLEHPECNIFKNFSRDTFNNIREGIIRCIL 849
            .|::|.|.......||..|: .|.:|.||.|....:|:....|||...|...:..:.|.|.:.|:
Human   834 RGFSNSYLQKFDHPLAALYS-TSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAII 897

  Fly   850 ATDMARH--NEILTQFMEITPIFDYSNRAHINLLCMILIKVADISNEARPMDVAEPWLDRLLQEF 912
            |||:|.:  |....:.|..|...:.:|::|.:.:..:::...|:.:..:...|.:...:.:..||
Human   898 ATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEF 962

  Fly   913 FAQSAAEKSEGLPVTPFMDPDKVSK-PGSQVRFIGLVLLPLFEALGELVPELTELIIIPVRIALE 976
            :|:....|..|:...|.||.||..: |..|:.|...|.:|.:..|.:::|. ||.::...|..|.
Human   963 WAEGDEMKKLGIQPIPMMDRDKKDEVPQGQLGFYNAVAIPCYTTLTQILPP-TEPLLKACRDNLS 1026

  Fly   977 YYRR-LNDAQTKT---RKSVADSNTSATSD 1002
            .:.: :...:|.|   ..||| ...:|:.|
Human  1027 QWEKVIRGEETATWISSPSVA-QKAAASED 1055

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde9NP_727644.3 PDEase_I 739..967 CDD:278654 71/230 (31%)
PDE10ANP_001372008.1 GAF 367..510 CDD:396252
GAF 543..698 CDD:214500
PDEase_I 790..1022 CDD:395177 71/235 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3689
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.