DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde9 and pde4a

DIOPT Version :9

Sequence 1:NP_727644.3 Gene:Pde9 / 32233 FlyBaseID:FBgn0259171 Length:1623 Species:Drosophila melanogaster
Sequence 2:XP_031755243.1 Gene:pde4a / 100488846 XenbaseID:XB-GENE-5789473 Length:744 Species:Xenopus tropicalis


Alignment Length:278 Identity:94/278 - (33%)
Similarity:153/278 - (55%) Gaps:16/278 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   703 MQTMFVELGFIEKFSIPVDTLREWLYEVYKHYN-EVPFHNFRHCFCVAQMMYAITRQANLLSRLG 766
            |.|:|.|...::.|.||||||..::..:..||: :|.:||..|...|.|..:.:.....|.:...
 Frog   368 MYTVFQERELLKTFKIPVDTLMTYMMTLEDHYHADVAYHNSLHAADVTQSTHVLLSTPALDAVFT 432

  Fly   767 DLECLILLVSCICHDLDHPGYNNIYQINARTELALRYNDISPLENHHCSIAFRLLEHPECNIFKN 831
            |||.|..|.:...||:||||.:|.:.||..:||||.|||.|.|||||.::.|:||:...|:||:|
 Frog   433 DLEILAALFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEENCDIFQN 497

  Fly   832 FSRDTFNNIREGIIRCILATDMARHNEILTQFMEITP-----------IFDYSNRAHINLLCMIL 885
            .::.....:|:.:|..:|||||::|..:|.....:..           :.:|::|..:   ...:
 Frog   498 LTKRQRQTMRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTSSGVLLLDNYTDRIQV---LRNM 559

  Fly   886 IKVADISNEARPMDVAEPWLDRLLQEFFAQSAAEKSEGLPVTPFMDPDKVSKPGSQVRFIGLVLL 950
            :..||:||..:|:::...|.||:|:|||.|...|:..|:.::|..|....|...|||.||..::.
 Frog   560 VHCADLSNPTKPLELYRQWTDRILEEFFRQGDKERERGMEISPMCDKHTASVEKSQVGFIDYIVH 624

  Fly   951 PLFEALGELV-PELTELI 967
            ||:|...:|| |:..:::
 Frog   625 PLWETWADLVHPDAQDIL 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde9NP_727644.3 PDEase_I 739..967 CDD:278654 80/239 (33%)
pde4aXP_031755243.1 PDE4_UCR 166..281 CDD:407935
PDEase_I 405..646 CDD:395177 80/241 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.