DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pde9 and pde2a

DIOPT Version :9

Sequence 1:NP_727644.3 Gene:Pde9 / 32233 FlyBaseID:FBgn0259171 Length:1623 Species:Drosophila melanogaster
Sequence 2:XP_021322214.1 Gene:pde2a / 100332468 -ID:- Length:851 Species:Danio rerio


Alignment Length:324 Identity:100/324 - (30%)
Similarity:167/324 - (51%) Gaps:16/324 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   705 TMFVELGFIEKFSIPVDTLREWLYEVYKHYNEVPFHNFRHCFCVAQMMYAITRQANLLSRLGDLE 769
            :||.::|||..:.|.:.||..:...|.|.|.:.|:||:.|.|.|:...|.:.:...|.:.|.|:|
Zfish   525 SMFEDMGFINTYKIDLHTLARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELSNYLQDIE 589

  Fly   770 CLILLVSCICHDLDHPGYNNIYQINARTELALRY-NDISPLENHHCSIAFRLLEHPECNIFKNFS 833
            .|.|.|||:||||||.|.||.:|:.:::.||..| ::.|.:|.||.:.|..:|....||||:.||
Zfish   590 ILALFVSCMCHDLDHRGTNNSFQVASQSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFEKFS 654

  Fly   834 RDTFNNIREGIIRCILATDMARHNEILTQFMEITPI-FDYSNRAHINLLCMILIKVADISNEARP 897
            |..:..:.:.:...|||||:|.|..|.....::..: |:.:||.|.:||..:|:...|:|::.:.
Zfish   655 RKDYQRMLDLMRDIILATDLAHHLRIFKDLQKMADVGFNPNNRTHRSLLLCLLMTSCDLSDQTKG 719

  Fly   898 MDVAEPWLDRLLQEFFAQSAAEKSEGLPVTPFMDPDKVSKPGSQVRFIGLVLLPLFEALGELVPE 962
            ........:.:.:|||:|...||:.|...:..||.:|...|..|:.|:..:.:|:::.|.|:.|.
Zfish   720 WKTTRKIAELIYKEFFSQGDLEKAMGNRPSEMMDREKAYIPELQISFMEHIAMPIYKLLQEIFPR 784

  Fly   963 LTELIIIPVRIALEYYRRLNDAQTKTRKSVADSNTSATSDSNSGT--IDSNAAMVSTPGGASDK 1024
            ..||           |.|:: |..:....|:...|.....||:..  :|....|:.:.|...|:
Zfish   785 SAEL-----------YERVS-ANREQWAKVSHKFTIRGLPSNNSLDFLDEEFEMLQSQGAFGDE 836

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pde9NP_727644.3 PDEase_I 739..967 CDD:278654 76/229 (33%)
pde2aXP_021322214.1 GAF 138..289 CDD:214500
GAF 311..462 CDD:214500
PDEase_I 559..789 CDD:306695 77/240 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D904682at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.