DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and GPT2

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_012993.3 Gene:GPT2 / 853941 SGDID:S000001775 Length:743 Species:Saccharomyces cerevisiae


Alignment Length:137 Identity:30/137 - (21%)
Similarity:57/137 - (41%) Gaps:39/137 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 VFPEGTRRNTGALHPFKKGAFHMAI-------DQQIPILPVVFSSYC---TFLNDKKKILNSGRI 228
            :||||...:..:|.|.|.|...||:       ..::.::|      |   .|..:|.:    .|.
Yeast   257 IFPEGGSHDRPSLLPIKAGVAIMALGAVAADPTMKVAVVP------CGLHYFHRNKFR----SRA 311

  Fly   229 VITTLPPVSTEG----LTKDD----IDVLMERVRSQMI---------ETFKVTSAEALHRYKPIK 276
            |:....|:..:|    :.||.    :..|::::.:.:.         :|..|..| |...|:|:|
Yeast   312 VLEYGEPIVVDGKYGEMYKDSPRETVSKLLKKITNSLFSVTENAPDYDTLMVIQA-ARRLYQPVK 375

  Fly   277 -KVGIPA 282
             ::.:||
Yeast   376 VRLPLPA 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 21/97 (22%)
GPT2NP_012993.3 LPLAT 45..348 CDD:418432 21/100 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.