DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and CST26

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_009598.1 Gene:CST26 / 852330 SGDID:S000000246 Length:397 Species:Saccharomyces cerevisiae


Alignment Length:259 Identity:52/259 - (20%)
Similarity:91/259 - (35%) Gaps:59/259 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LMYYGIVSFNSIILIPAFLTRPCDVRNLLWASTWCHRVSTLIGLRWELRGKEHLAKDQACIIVAN 100
            ::.:|:.::|.|     |::|.       ||.......::|.||....||...||......|...
Yeast   147 ILGFGMRNYNFI-----FMSRK-------WAQDKITLSNSLAGLDSNARGAGSLAGKSPERITEE 199

  Fly   101 HQSSLDVLGMFNIWHVMNKCTVVAKRELFYAWPFGLAAWLAGLIFIDRVRGEKARETLNDVNRRI 165
            .:|         ||:.    .|:..:::.  ||:.|..:..|.......|.:.|:..     .:|
Yeast   200 GES---------IWNP----EVIDPKQIH--WPYNLILFPEGTNLSADTRQKSAKYA-----AKI 244

  Fly   166 KKQRIKLWVFPE--GTRRNTGALHPFKKGAFHMAID----QQIPILPVVFSSYCTFLNDKKKILN 224
            .|:..|..:.|.  |.|.:...|.|..:..:.:.|.    :|.....:::.....||..|...|.
Yeast   245 GKKPFKNVLLPHSTGLRYSLQKLKPSIESLYDITIGYSGVKQEEYGELIYGLKSIFLEGKYPKLV 309

  Fly   225 SGRIVITTLPPVS-------TEGLTK--DDIDVLMERVRS------------QMIETFKVTSAE 267
            ...|....:..:.       :|.|.|  .:.|.||||..|            .:.::||:...|
Yeast   310 DIHIRAFDVKDIPLEDENEFSEWLYKIWSEKDALMERYYSTGSFVSDPETNHSVTDSFKINRIE 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 41/198 (21%)
CST26NP_009598.1 LPLAT_LCLAT1-like 103..314 CDD:153252 39/198 (20%)
Acyltransf_C 300..372 CDD:406475 16/71 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.