DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and GPAT3

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_016864269.1 Gene:GPAT3 / 84803 HGNCID:28157 Length:526 Species:Homo sapiens


Alignment Length:283 Identity:70/283 - (24%)
Similarity:107/283 - (37%) Gaps:70/283 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FLLLMLPFLYETNHIFRYYFKF-----LMYYGIVSFNSIILIPAFLTRPCDVRNLL-WASTWCHR 72
            ::.|.|..::....|.||....     |.:.||    |:::|...|.......:|. |.|...|.
Human   228 YISLRLTMVWVLGVIVRYCVLLPLRVTLAFIGI----SLLVIGTTLVGQLPDSSLKNWLSELVHL 288

  Fly    73 VSTLIGLRWELRGKEHLAKDQ-----ACIIVANHQSSLDVL-----GMF-NIWHVMNKCTVVAKR 126
            ....|.:| .|.|..|....|     ..|.||||.|.:|||     |.: .:..|......:.:|
Human   289 TCCRICVR-ALSGTIHYHNKQYRPQKGGICVANHTSPIDVLILTTDGCYAMVGQVHGGLMGIIQR 352

  Fly   127 ELFYAWPFGLAAWLAGLIFIDRVRGEKARETLND---VNRRIK-----KQRIKLWVFPEGTRRNT 183
            .:..|.|.   .|.             .|..:.|   |.:|:|     |:::.:.:|||||..|.
Human   353 AMVKACPH---VWF-------------ERSEMKDRHLVTKRLKEHIADKKKLPILIFPEGTCINN 401

  Fly   184 GALHPFKKGAFHMAIDQQIPILPVV------FSSYCTFLNDKK--------KILNSGRIV--ITT 232
            .::..||||:|.:.    ..|.||.      |..  .|.|..|        :::.|..||  :..
Human   402 TSVMMFKKGSFEIG----GTIHPVAIKYNPQFGD--AFWNSSKYNMVSYLLRMMTSWAIVCDVWY 460

  Fly   233 LPPVSTEGLTKDDIDVLMERVRS 255
            :||::.|  ..:|......||:|
Human   461 MPPMTRE--EGEDAVQFANRVKS 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 54/218 (25%)
GPAT3XP_016864269.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.