DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and ATS2

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_194787.2 Gene:ATS2 / 829181 AraportID:AT4G30580 Length:356 Species:Arabidopsis thaliana


Alignment Length:264 Identity:62/264 - (23%)
Similarity:107/264 - (40%) Gaps:51/264 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ITMTSFIELLGL---FLLLMLPFLYETNHIFRYYFKFLMYYGIVSFNSIILIPAFLTRPCDVRNL 63
            |:.|..|.|:.:   |:||..|:..:.:|                         |:.:       
plant   136 ISATFLIVLMIIGHPFVLLFDPYRRKFHH-------------------------FIAK------- 168

  Fly    64 LWASTWCHRVSTLIGLRWELRGKEHL-AKDQACIIVANHQSSLDVLGMFNIWHVMNKCTVVAKRE 127
            ||||     :|.....:..:.|.|:| :.|...:.|:||||.||:   :.:..:......::|..
plant   169 LWAS-----ISIYPFYKINIEGLENLPSSDTPAVYVSNHQSFLDI---YTLLSLGKSFKFISKTG 225

  Fly   128 LFYAWPFGLAAWLAGLIFIDRVRGEKARETLNDVNRRIKKQRIKLWVFPEGTRRNTGALHPFKKG 192
            :|.....|.|..:.|::.:.|:......:.|......:|| ...::.||||||...|.|..||||
plant   226 IFVIPIIGWAMSMMGVVPLKRMDPRSQVDCLKRCMELLKK-GASVFFFPEGTRSKDGRLGSFKKG 289

  Fly   193 AFHMAIDQQIPILPVVFSSYCTFL-NDKKKILNSGRIVITTLPPVSTEGLTKDDIDVLMERVRSQ 256
            ||.:|....:.::|:........: ...:.|||.|.:.:....|:.     ....|||....||:
plant   290 AFTVAAKTGVAVVPITLMGTGKIMPTGSEGILNHGNVRVIIHKPIH-----GSKADVLCNEARSK 349

  Fly   257 MIET 260
            :.|:
plant   350 IAES 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 45/185 (24%)
ATS2NP_194787.2 PLN02901 145..356 CDD:215488 58/255 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I4003
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I2541
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1623097at2759
OrthoFinder 1 1.000 - - FOG0001236
OrthoInspector 1 1.000 - - otm2746
orthoMCL 1 0.900 - - OOG6_100535
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.