DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and Lpcat2b

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_081875.1 Gene:Lpcat2b / 70902 MGIID:1918152 Length:516 Species:Mus musculus


Alignment Length:252 Identity:52/252 - (20%)
Similarity:98/252 - (38%) Gaps:48/252 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VSFNSIILIPAFLTRPCDVRNLLWASTWCHRVSTLI-----------GLRWELRGKEHLAKDQAC 95
            |:..|.|.:|...|:|  :|.  |..   |.:.:.:           |...:::||:...::...
Mouse    79 VAVLSAINLPTQPTKP--IRR--WRK---HLIKSALVFLFRLGFFFAGFLVKVKGKKATREEAPI 136

  Fly    96 IIVANHQSSLDVLGMFNIWHVMNKCTVVAKRELFYAWPFGLAAWLAGLIFIDRVRGEKARETLND 160
            .:.|.|.:..|.:.:.    |....:||:..:|......|....:...:.:.|......:.|.|:
Mouse   137 FVSAPHSTFFDAIAVV----VAGLPSVVSDSQLARVPLAGKCILVTQPVLVKREDPNSRKTTRNE 197

  Fly   161 VNRRIKKQR--IKLWVFPEGTRRNTGALHPFKKGAFHMAIDQQIPILPVV--------------- 208
            :.||:|.:.  .::.:||||...|...|..||.|||    ...:|:.||:               
Mouse   198 ILRRVKSKMKWPQILIFPEGLCTNRSCLVTFKLGAF----SPGVPVQPVLLRYPNSLDTVTWTWN 258

  Fly   209 -FSSYCTFLNDKKKILNSGRIVITTLPP-VSTEGLTKDDIDVLMERVRSQMIETFKV 263
             ||.:...:....::..  |:.:..:|. :.:|...||.| :....||.:|....|:
Mouse   259 GFSGFQVCMLTLSQLFT--RVEVEFMPVYIPSEEEKKDPI-LFANTVRIKMANALKL 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 40/213 (19%)
Lpcat2bNP_081875.1 PlsC 65..307 CDD:223282 50/245 (20%)
LPLAT_LPCAT1-like 111..323 CDD:153253 43/213 (20%)
HXXXXD motif 142..147 1/4 (25%)
EFh 392..454 CDD:238008
EF-hand_7 392..453 CDD:290234
EFh 429..487 CDD:298682
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.