DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and Aup1

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001073368.1 Gene:Aup1 / 680423 RGDID:1591777 Length:410 Species:Rattus norvegicus


Alignment Length:311 Identity:74/311 - (23%)
Similarity:111/311 - (35%) Gaps:90/311 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LGLFLLLMLPFLYETNHIFRYYFKFLMYYGIVSFNSIILIPAFLTRPCDVRNLLWASTWCHRVST 75
            :||.||::..||  ..|:|           :||    ..:|..:.|...||      |.|    .
  Rat    34 VGLCLLVLRLFL--GLHVF-----------LVS----CALPDSVLRRFVVR------TMC----A 71

  Fly    76 LIGL--RWELRG-KEHLAKDQACIIVANHQSSLDVLGMFNIWHVMNKCTVVAKRELFYAWPFGLA 137
            ::||  |.|..| ::|..:    ::::||.:..|    .||.:::..|:......     |....
  Rat    72 VLGLVARQEDSGLRDHRVR----VLISNHVTPFD----HNIVNLLTTCSTPLLNS-----PPSFV 123

  Fly   138 AWLAGLIFIDRVRGEKARETLNDVNRRIKKQRIKLWVFP--EGTRRNTGALHPFKKGAFHMAIDQ 200
            .|..|.:.:|| |.|.. |:|.......:.....|.:||  |.|....|.|.             
  Rat   124 CWSRGFMEMDR-RVELV-ESLKKFCASTRLPPTPLLLFPEEEATNGREGLLR------------- 173

  Fly   201 QIPILPVVFSSYCTFLNDKKKILNSGRIVITTL----PPVSTEGLTKDDIDVLMERVRSQMIETF 261
                    |||:...:.|..:.|        ||    |.||   :|..|...:.|.:.|..: .|
  Rat   174 --------FSSWPFSIQDVVQPL--------TLQVQRPLVS---VTVSDASWVSELLWSLFV-PF 218

  Fly   262 KVTSAEALHRYKPIKK-VGIPAASSA-STSSTTTTTLASPGTAVTPVADAA 310
            .|.....||   ||:: :|......| .........|...||.:|| ||.|
  Rat   219 TVYQVRWLH---PIRRQLGEENEEFALRVQQLVAKELGQIGTRLTP-ADKA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 42/192 (22%)
Aup1NP_001073368.1 LPLAT 66..264 CDD:302626 60/259 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..293 5/8 (63%)
CUE_AUP1 300..340 CDD:270603
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.