DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and gpat4

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001035339.2 Gene:gpat4 / 678522 ZFINID:ZDB-GENE-060421-5102 Length:451 Species:Danio rerio


Alignment Length:239 Identity:53/239 - (22%)
Similarity:89/239 - (37%) Gaps:79/239 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VSTLIGL------RWELRGKEHLAKDQAC---------------------IIVANHQSSLDVLGM 110
            :::::||      :..|..|.||...:.|                     |.||||.|.:||:.:
Zfish   188 LTSIVGLFPNGRMKNYLSDKVHLMCYRICVRALTAIITYHDSENKPKNGGICVANHTSPIDVIIL 252

  Fly   111 FN------IWHVMNKCTVVAKRELFYAWPFGLAAWLAGLIFIDRVRGEKARETLND---VNRRIK 166
            .:      :..|......|.:|.:..|.|.   .|.             .|..:.|   |.:|:.
Zfish   253 ASDGCYAMVGQVHGGLMGVIQRAMVKACPH---IWF-------------ERSEVKDRHLVAKRLS 301

  Fly   167 -----KQRIKLWVFPEGTRRNTGALHPFKKGAFHMAIDQQIPILPVVF------------SSYCT 214
                 :.::.:.:|||||..|..::..||||:|.:.    ..:.||..            ||...
Zfish   302 DHVADESKLPILIFPEGTCINNTSVMMFKKGSFEIG----CTVYPVAIKYDPRFGDAFWNSSKFG 362

  Fly   215 FLNDKKKILNSGRIVITT--LPPVS-TEGLTKDDIDVLMERVRS 255
            .:|....:::|..||.:.  |||:| .||   :|......||::
Zfish   363 MVNYLLHMMSSWAIVCSVWYLPPMSRMEG---EDAVQFANRVKA 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 52/236 (22%)
gpat4NP_001035339.2 LPLAT_LPCAT1-like 213..422 CDD:153253 47/214 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.