DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and AGPAT4

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_064518.1 Gene:AGPAT4 / 56895 HGNCID:20885 Length:378 Species:Homo sapiens


Alignment Length:271 Identity:60/271 - (22%)
Similarity:105/271 - (38%) Gaps:64/271 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IELLGLFLLLMLPFLYETNHIFRYYFKFLMYYGIVSFNSIILIPAFLTRPCDVRNLLWASTWCHR 72
            |..:.||.||:.|.   ...:||.....|.|  .:|...::|:.            .|:.|.|  
Human    28 INTIQLFTLLLWPI---NKQLFRKINCRLSY--CISSQLVMLLE------------WWSGTEC-- 73

  Fly    73 VSTLIGLRWELR-GKEHLAKDQACIIVANHQSSLDVLGMFNI---WHVMNKCTVVAKRELFYAWP 133
             :.....|..|: |||:      .|:|.||:..:|.|..:::   :.::....|:||:||.|...
Human    74 -TIFTDPRAYLKYGKEN------AIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPI 131

  Fly   134 FGLAAWLAGLIFIDRVRGEKARET-------LNDVNRRI-------------KKQRIKLWVF-PE 177
            .|...:...::|..| :.|:.|:|       |.|...:.             ||..|.:.|. .:
Human   132 IGWMWYFTEMVFCSR-KWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAK 195

  Fly   178 GTRRNTGALHPFKKGAFHMAIDQQIPILPVVFSSYCTFLNDKKK----ILNSGR----IVITTLP 234
            |..|....|.|..|| |.:.:.....::..|:.....|.|::..    :||..:    :.:..:|
Human   196 GLPRLKHHLLPRTKG-FAITVRSLRNVVSAVYDCTLNFRNNENPTLLGVLNGKKYHADLYVRRIP 259

  Fly   235 PVSTEGLTKDD 245
               .|.:.:||
Human   260 ---LEDIPEDD 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 46/209 (22%)
AGPAT4NP_064518.1 PLN02380 20..345 CDD:178006 60/271 (22%)
LPLAT_LCLAT1-like 62..256 CDD:153252 45/216 (21%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 96..101 1/4 (25%)
Acyltransf_C 243..314 CDD:292694 6/28 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.