DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and Agpat5

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_081068.1 Gene:Agpat5 / 52123 MGIID:1196345 Length:365 Species:Mus musculus


Alignment Length:266 Identity:58/266 - (21%)
Similarity:93/266 - (34%) Gaps:80/266 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RGKEHLAKDQACIIVANHQSSLDVLGMFNIWHV----------MNKCTVVAKRELFYAWPFGLAA 138
            :.||::      |.:|||||::|       |.|          :.....|.|.:|.:...:|...
Mouse    82 KNKENV------IYLANHQSTVD-------WIVADMLAARQDALGHVRYVLKDKLKWLPLYGFYF 133

  Fly   139 WLAGLIFIDRVRGEKARETLNDVNRRIKKQR-------IKLWVFPEGTRRNT------GALHPF- 189
            ...|.|::      |.....||...|.|.|.       :.|.:||||||.|.      .|...| 
Mouse   134 AQHGGIYV------KRSAKFNDKEMRSKLQSYVNAGTPMYLVIFPEGTRYNATYTKLLSASQAFA 192

  Fly   190 -KKG-------------AFHMAIDQQIPILPVVFSSYCTFLNDKKKILNSGRIVITTLPPVSTEG 240
             ::|             |.|:|.|.....|..::.....:..::|   .||:.   :.||..||.
Mouse   193 AQRGLAVLKHVLTPRIKATHVAFDSMKSHLDAIYDVTVVYEGNEK---GSGKY---SNPPSMTEF 251

  Fly   241 LTK--------------DDIDVLMERVRSQMIETFKVTSAEALHRY---KPIKKVGIPAASSAST 288
            |.|              :::....|.::..:.|.|::.....:..|   .|.::...|..|..|.
Mouse   252 LCKQCPKLHIHFDRIDRNEVPEEQEHMKKWLHERFEIKDRLLIEFYDSPDPERRNKFPGKSVHSR 316

  Fly   289 SSTTTT 294
            .|...|
Mouse   317 LSVKKT 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 49/221 (22%)
Agpat5NP_081068.1 LPLAT_LCLAT1-like 63..264 CDD:153252 48/206 (23%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 93..98 3/4 (75%)
Acyltransf_C 260..319 CDD:292694 8/58 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.