DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and agpat4

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_998157.1 Gene:agpat4 / 406265 ZFINID:ZDB-GENE-040426-1924 Length:377 Species:Danio rerio


Alignment Length:288 Identity:62/288 - (21%)
Similarity:106/288 - (36%) Gaps:78/288 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LGLFLLLMLPFLYETNHIFRYYFKFLMYYGIVSFNSIILIPAF-----LTRPCDVR--------- 61
            :||..:|....|.   |:...|. ||:...|::...:..:|.:     |.|..:.|         
Zfish     1 MGLLKVLKTQLLC---HLIICYV-FLVSGIIINLLQLCTLPLWPINKQLARKINCRLGYSIASQL 61

  Fly    62 -NLL--WASTWCHRVSTLIGLRWELRGKEHLAKDQACIIVANHQSSLDVLGMFNI---WHVMNKC 120
             .||  |:.|.|...:.....|  |.|||:      .|:|.||...:|.:..:..   :.|:...
Zfish    62 VALLEWWSGTECTLYTDPESFR--LYGKEN------AIVVLNHNFEIDFMTGWTFCERFGVLGSS 118

  Fly   121 TVVAKRELFYAWPFGLAAWLAGLIFIDRVRGEKARETLNDVNRRIKKQRIKLW--VFPEGTRRNT 183
            .|:||:||.:....|...:...::|..| :.|:.|.|:....|.::......|  :..||||...
Zfish   119 KVLAKKELSFVPVIGWMWYFLEIVFCKR-KWEEDRNTVVQSLRNLQDYPEFFWFLLHCEGTRFTE 182

  Fly   184 GALHPFKKGAFHMAIDQQ--IP-----ILP-----------------VVFSSYCTFLNDKKK--- 221
                  ||....|.:.::  :|     :||                 .|:.|...|.|::..   
Zfish   183 ------KKHKISMEVAEKKGLPKLKYHLLPRTKGFCVTVQNLRGKVTAVYDSTLNFRNNEMPTLL 241

  Fly   222 -ILNS---------GRIVITTLPPVSTE 239
             :||.         .||.:.::|...:|
Zfish   242 GVLNGKKYHADLYVRRIPLDSIPEDESE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 45/212 (21%)
agpat4NP_998157.1 PLN02380 20..320 CDD:178006 56/266 (21%)
LPLAT_LCLAT1-like 62..256 CDD:153252 45/208 (22%)
Acyltransf_C 243..314 CDD:292694 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.