DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and tmem68

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_956786.1 Gene:tmem68 / 393464 ZFINID:ZDB-GENE-040426-1267 Length:331 Species:Danio rerio


Alignment Length:234 Identity:47/234 - (20%)
Similarity:86/234 - (36%) Gaps:69/234 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SFIELL-----GLFLLLMLPFLYETNHIFRYYFKFLMYYGIVSFNSIILIPAFLTRPCDVR---- 61
            :|:|.|     .|.::.:||||          ...|:|.      ||:.:..: .|...:|    
Zfish    39 NFLEYLVWVFTPLVVVFILPFL----------IVILLYL------SILFLHVY-KRKNQLREAYS 86

  Fly    62 NLLW-------ASTWCHRVSTLIGLRW---ELRGKEHLAKDQACIIVANHQSSLDVLGMFNIWHV 116
            |.||       |:.|...     |..|   |:.|.:.:..:...:||..|       |...:.:.
Zfish    87 NNLWDGARKTLATLWDGH-----GAIWHGYEIHGLDKIPDEGPALIVYYH-------GAIPVDYY 139

  Fly   117 MNKCTVVAKRELFYAWPFGLAAWLAGLIFIDRVRGEKARETLNDVNRRIKKQRIK-------LWV 174
            ....||:.::        |.........|:.:|.|.|....:..|....:::.::       |.:
Zfish   140 YFLATVIIQK--------GRTCHSVADHFLFKVPGFKLLLEVFSVIHGPQEECVRALRNGHLLGI 196

  Fly   175 FPEGTRRN--TGALHPF----KKGAFHMAIDQQIPILPV 207
            .|.|.|..  :...:|.    :||...:|||.::|::|:
Zfish   197 SPGGVREALFSDETYPLLWGKRKGFAQVAIDSKVPVIPM 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 28/154 (18%)
tmem68NP_956786.1 PlsC 51..310 CDD:223282 44/222 (20%)
LPLAT_MGAT-like 104..311 CDD:153249 28/152 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.