DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and Gpat4

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001286818.1 Gene:Gpat4 / 37852 FlyBaseID:FBgn0034971 Length:537 Species:Drosophila melanogaster


Alignment Length:215 Identity:54/215 - (25%)
Similarity:83/215 - (38%) Gaps:57/215 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 IIVANHQSSLDVLGMF--NIWHVMNK----CTVVAKRELFYAWPFGLAAWLAGLIFIDRVRGEKA 154
            |.||||.|.:|||.:.  :.:.::.:    ...|.:|.|..|.|.   .|..        |||..
  Fly   329 ICVANHTSPIDVLVLMCDSTYSLIGQRHGGFLGVLQRALARASPH---IWFE--------RGEAK 382

  Fly   155 RETLNDVNRRIKKQRIK----------LWVFPEGTRRNTGALHPFKKGAFHMAIDQQIPILPVV- 208
                   :|.:..:|:|          :.:|||||..|..::..||||:|.:.    ..|.||. 
  Fly   383 -------DRHLVAERLKQHVSDPNNPPILIFPEGTCINNTSVMQFKKGSFEVG----GVIYPVAI 436

  Fly   209 -----FSSYCTFLNDKK--------KILNSGRIV--ITTLPPV-STEGLTKDDIDVLMERVRSQM 257
                 |..  .|.|..|        .::.|..||  :..|||: ..||.:..|....::.|.::.
  Fly   437 KYDPRFGD--AFWNSAKYSMMQYLYMMMTSWAIVCDVWYLPPMYRQEGESAIDFANRVKSVIAKQ 499

  Fly   258 IETFKVTSAEALHRYKPIKK 277
            .....:.....|.|.||.|:
  Fly   500 GGLIDLVWDGQLKRMKPKKE 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 48/190 (25%)
Gpat4NP_001286818.1 LPLAT_LPCAT1-like 307..513 CDD:153253 50/207 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.