DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and CG15450

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_608409.1 Gene:CG15450 / 33064 FlyBaseID:FBgn0031132 Length:407 Species:Drosophila melanogaster


Alignment Length:179 Identity:46/179 - (25%)
Similarity:67/179 - (37%) Gaps:61/179 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 IIVANHQSSLDVLGMFNIWHVMNKCTVVAKRELFYAWPFGLAAWLAGLI--FIDRV-------RG 151
            |.|.||.|.||||              |...:..|:....:...:.|::  .:.||       |.
  Fly   215 ICVCNHTSPLDVL--------------VLMCDANYSLTGQVHTGILGVLQRALSRVSHHMWFDRK 265

  Fly   152 EKA-RETLNDVNRR--IKKQRIKLWVFPEGTRRNTGALHPFKKGAFHMAIDQQIPI--------- 204
            |.| ||.|..|.|.  ..|.|..:.:|||||..|..|:..||||:|.:: |...|:         
  Fly   266 ELADREALGLVLRLHCSMKDRPPVLLFPEGTCINNTAVMQFKKGSFAVS-DVVHPVAIRYDRRFG 329

  Fly   205 --------------LPVVFSSYC-----------TFLNDKKKILNSGRI 228
                          :.:|.||:|           :..||:..:..|.|:
  Fly   330 EAYWDSTRYSMLRYMLMVVSSWCICCDVWYMPALSRCNDESPVEFSNRV 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 46/179 (26%)
CG15450NP_608409.1 LPLAT_LPCAT1-like 191..399 CDD:153253 46/179 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.