DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and CG34348

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001096954.1 Gene:CG34348 / 32072 FlyBaseID:FBgn0085377 Length:323 Species:Drosophila melanogaster


Alignment Length:292 Identity:54/292 - (18%)
Similarity:99/292 - (33%) Gaps:70/292 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MTSFIEL-----LGLFLL-LMLPFLYETNHIFRYYFKFLMYYGIVSFNSIILIPAFLTRPCDVRN 62
            ::|:|:|     |..||. |::.||.....:...|..||:.:.......:|:      |......
  Fly    15 LSSYIDLDYSLWLYRFLTPLIVTFLLPLVFVALIYISFLVLFIYKLHRQVIM------RAVQGDR 73

  Fly    63 LLW-------ASTWCHRVSTLIGLRWELRGKEHLAKDQACIIVANHQS-SLDVLGMFNIWHVMNK 119
            ..|       |:.|........|  :|:.|.|::.::...:||..|.: .:|:       :.:|.
  Fly    74 NFWRVGRKIVAAIWDAHARIYHG--YEVIGLENVPQEGPALIVYYHGAIPIDM-------YYLNS 129

  Fly   120 CTVVAKRELFYA----WPFGLAAW--LAGLIFIDRVRGEKARETLNDVNRRIKKQRIKLWVFPEG 178
            ..::.:..|.|.    :.|.|..|  ::....:.....:.....|.|.|        .|.:.|.|
  Fly   130 RMLLQRERLIYTIGDRFLFKLPGWGTISEAFHVSPGTVQSCVSILRDGN--------LLAISPGG 186

  Fly   179 TRRNTGALHPF------KKGAFHMAIDQQIPILPVV-------FSSYCTFLNDKKKILNSGRIVI 230
            ........|.:      :.|...:||:.:.||:|..       |.....|.....::.|..||.:
  Fly   187 VYEAQFGDHYYELLWRNRVGFAKVAIEAKAPIIPCFTQNLREGFRQVGIFRTFFMRLYNKVRIPV 251

  Fly   231 TTL--------------PPVSTEGLTKDDIDV 248
            ..:              |....|.||..|:.:
  Fly   252 YPIYGGFPVKFRTYLGKPIPYDENLTPQDLQI 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 37/213 (17%)
CG34348NP_001096954.1 PlsC 47..271 CDD:223282 41/246 (17%)
LPLAT_MGAT-like 90..298 CDD:153249 37/211 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.