DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and Tmem68

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001101373.1 Gene:Tmem68 / 312946 RGDID:1309006 Length:329 Species:Rattus norvegicus


Alignment Length:314 Identity:70/314 - (22%)
Similarity:109/314 - (34%) Gaps:97/314 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLGLF---LLLMLPFLYETNHIFRYYFKFLMYYGIVSFN----SIILIPAFLTRPCDVRNLLWAS 67
            ||.:|   :||:||          |:..||:|..|:..:    ..:|..|:.....|......|:
  Rat    44 LLWVFTPLILLILP----------YFTIFLLYLTIIFLHIYKRKNVLKEAYSHNLWDGARKTVAT 98

  Fly    68 TWCHRVSTLIGLRWELRGKEHLAKDQACIIVANHQSSLD-VLGMFNIW-HVMNKCTVVAKRELFY 130
            .|....:...|  :|:.|.|.:.:..|.||..:....:| ...|..|: |....|.|||...:|.
  Rat    99 LWDGHAAVWHG--YEVHGMEKIPEGPALIIFYHGAIPIDFYYFMAKIFIHKGRTCRVVADHFVFK 161

  Fly   131 AWPFGLAAWLAGLIFIDRVRG--EKARETLNDVNRRIKKQRIKLWVFPEGTR------RNTGALH 187
            ...|.|.     |.....:.|  ||..|.|...:        .|.:.|.|.|      .....:.
  Rat   162 IPGFSLL-----LDVFCALHGPREKCVEILRSGH--------LLAISPGGVREALLSDETYNIIW 213

  Fly   188 PFKKGAFHMAIDQQIPILPVV-------FSS----------------------------YCTFLN 217
            ..:||...:|||.::||:|:.       |.|                            ..|||.
  Rat   214 GNRKGFAQVAIDAKVPIIPMFTQNIREGFRSLGGTRLFKWLYEKFRYPFAPMYGGFPVKLRTFLG 278

  Fly   218 DKKKILNSGRIVITTLPPVSTEGL---TKDDIDVLMER-------VRSQMIETF 261
            |.          |...|.|:.|.|   ||:.:..|:::       :||.:::.|
  Rat   279 DP----------IPYDPEVTAEELAEKTKNAVQALIDKHQRIPGNIRSALLDRF 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 50/238 (21%)
Tmem68NP_001101373.1 LPLAT_MGAT-like 103..309 CDD:153249 50/230 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.