DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and Agpat5

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_017455638.1 Gene:Agpat5 / 306582 RGDID:1306405 Length:365 Species:Rattus norvegicus


Alignment Length:236 Identity:58/236 - (24%)
Similarity:88/236 - (37%) Gaps:85/236 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RGKEHLAKDQACIIVANHQSSLDVLGMFNIWHVMNKCTVVAKRE-----LFYAWPFGLAAWLA-- 141
            :.||::      |.:|||||::|       |.|.:   ::|.|:     :.|....|| .||.  
  Rat    82 KNKENV------IYLANHQSTVD-------WIVAD---MLAARQDALGHVRYVLKDGL-KWLPLY 129

  Fly   142 -------GLIFIDRVRGEKARETLNDVNRRIKKQR-------IKLWVFPEGTRRNT------GAL 186
                   |.|::      |.....||...|.|.|.       :.|.:||||||.|.      .|.
  Rat   130 GFYFAQHGGIYV------KRSAKFNDKEMRSKLQSYVNAGTPMYLVIFPEGTRYNATYTKLLSAS 188

  Fly   187 HPF--KKG-------------AFHMAIDQQIPILPVVFSSYCTFLNDKKKILNSGRIVITTLPPV 236
            ..|  ::|             |.|:|.|.....|..::.....:..::|   |||:.   :.||.
  Rat   189 QAFAAQRGLAVLKHVLTPRIKATHVAFDSMKSHLDAIYDVTVVYEGNEK---NSGKY---SNPPS 247

  Fly   237 STEGLTK---------DDID-----VLMERVRSQMIETFKV 263
            .||.|.|         |.||     ...|.::..:.|.|::
  Rat   248 MTEFLCKQCPRLHIHFDRIDRKEVPEEQEHMKKWLHERFEI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 56/225 (25%)
Agpat5XP_017455638.1 LPLAT_LCLAT1-like 63..264 CDD:153252 52/210 (25%)
Acyltransf_C 251..320 CDD:406475 8/38 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.