DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and Gpat3

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001020841.1 Gene:Gpat3 / 305166 RGDID:1565703 Length:457 Species:Rattus norvegicus


Alignment Length:337 Identity:85/337 - (25%)
Similarity:124/337 - (36%) Gaps:97/337 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IFRYYFKF-----LMYYGIVSFNSIILIPAFLTRPCDVRNLL-WASTWCHRVSTLIGLRWELRGK 86
            :.||.|..     |.:.||    |:::|...|.......:|. |.|...|.....|.:| .|.|.
  Rat   150 LVRYCFLLPLRVTLAFIGI----SLLIIGTTLVGQLPDSSLKNWLSELVHLTCCRICVR-SLSGT 209

  Fly    87 EHLAKDQ-----ACIIVANHQSSLDVL-----GMF-NIWHVMNKCTVVAKRELFYAWPFGLAAWL 140
            .|....|     ..|.||||.|.:|||     |.: .:..|......:.:|.:..|.|.   .|.
  Rat   210 IHYHNKQYRPQKGGICVANHTSPIDVLILATDGCYAMVGQVHGGLMGIIQRAMVKACPH---VWF 271

  Fly   141 AGLIFIDRVRGEKARETLND---VNRRIK-----KQRIKLWVFPEGTRRNTGALHPFKKGAFHMA 197
                         .|..:.|   |.:|:|     |:::.:.:|||||..|..::..||||:|.:.
  Rat   272 -------------ERSEIKDRHLVTKRLKEHIADKKKLPILIFPEGTCINNTSVMMFKKGSFEIG 323

  Fly   198 IDQQIPILPVV------FSSYCTFLNDKK--------KILNSGRIV--ITTLPPVSTE------- 239
                ..|.||.      |..  .|.|..|        :|:.|..||  :..:||::.|       
  Rat   324 ----GTIYPVAIKYNPQFGD--AFWNSSKYNLVSYLLRIMTSWAIVCDVWYMPPMTREEGEDAVQ 382

  Fly   240 -------------GLTKDDIDVLMERVRSQMIETFKVTSAEALHRY-KPIKKVGIPAASSASTSS 290
                         |||:...|..::|.:.:  :|||   .|....| |.|...|.|   |.:..|
  Rat   383 FANRVKSAIAVQGGLTELPWDGGLKRAKVK--DTFK---EEQQKTYSKMIVGNGSP---SLALDS 439

  Fly   291 TTTTTLASPGTA 302
            :|.....||..|
  Rat   440 STVDNHGSPEPA 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 58/238 (24%)
Gpat3NP_001020841.1 LPLAT_LPCAT1-like 199..408 CDD:153253 56/231 (24%)
HXXXXD motif. /evidence=ECO:0000250|UniProtKB:Q9D517 229..234 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 429..457 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.