DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Agpat1 and Lpcat4

DIOPT Version :9

Sequence 1:NP_001259494.1 Gene:Agpat1 / 32230 FlyBaseID:FBgn0030421 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001099964.1 Gene:Lpcat4 / 296048 RGDID:1311177 Length:522 Species:Rattus norvegicus


Alignment Length:225 Identity:51/225 - (22%)
Similarity:79/225 - (35%) Gaps:54/225 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PFLYETNHIFRYYFKFLMYYGIVSFNSIILIPAFLTRPCDVRNLLWASTW--------------- 69
            ||::|.:.......||.:.       .::|.|..:.....|..|||...|               
  Rat    24 PFVHELHLSGLQRVKFCLL-------GVLLAPIRVLLAFIVLFLLWPFAWLQVAGLTEEQLQEPI 81

  Fly    70 -------CHR--------VSTLIG-LRWELRGKEHLAKDQACIIVANHQSSLDVLGMFNIWHVMN 118
                   ||.        :..|:| ||..:||:.....:...::.|.|.:..|.:       |:.
  Rat    82 TGWRKTVCHNGVLGLSRLLFFLLGFLRIRVRGQRASRLEAPVLVAAPHSTFFDPI-------VLL 139

  Fly   119 KC---TVVAKRELFYAWPFGLAAWLAGLIFIDRVRGEKARETLNDVNRRIKK--QRIKLWVFPEG 178
            .|   .||::.|.......|........|.:.|......|..:.:|.||...  :..::..||||
  Rat   140 PCDLPKVVSRAENLSVPVIGALLRFNQAILVSRHDPASRRRVVEEVRRRATSGGKWPQVLFFPEG 204

  Fly   179 TRRNTGALHPFKKGAFHMAIDQQIPILPVV 208
            |..|..||..||.|||...    :|:.||:
  Rat   205 TCSNKKALLKFKPGAFIAG----VPVQPVL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Agpat1NP_001259494.1 LPLAT_AGPAT-like 70..254 CDD:153251 39/153 (25%)
Lpcat4NP_001099964.1 LPLAT_LPCAT1-like 109..306 CDD:153253 33/133 (25%)
PlsC 109..295 CDD:223282 33/133 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0204
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.